Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S6W6

Protein Details
Accession A0A1Y1S6W6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
133-158IRNYLKYTAMPKKRRKAMPRMFIYSAHydrophilic
NLS Segment(s)
PositionSequence
144-148KKRRK
Subcellular Location(s) plas 7E.R. 7, mito 6, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
Amino Acid Sequences MFVGFVSLIMAAFNQHDILVKIDMLHKKTGVSTFYELFNVRKDASMTQINHVFRKANKSQVNPYKGKLSDSEYKSLIMTAYSTLKNHREKYDGVLANGKMIFINHKKNFKTNSLTLILFGIITIVLVDFSVFIRNYLKYTAMPKKRRKAMPRMFIYSAYAKIKGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.12
6 0.12
7 0.11
8 0.12
9 0.18
10 0.23
11 0.25
12 0.26
13 0.24
14 0.24
15 0.27
16 0.29
17 0.24
18 0.23
19 0.24
20 0.23
21 0.24
22 0.25
23 0.24
24 0.21
25 0.22
26 0.2
27 0.17
28 0.17
29 0.18
30 0.16
31 0.2
32 0.26
33 0.24
34 0.26
35 0.32
36 0.32
37 0.32
38 0.32
39 0.31
40 0.25
41 0.32
42 0.31
43 0.35
44 0.39
45 0.42
46 0.5
47 0.56
48 0.61
49 0.55
50 0.54
51 0.51
52 0.46
53 0.43
54 0.35
55 0.32
56 0.33
57 0.34
58 0.35
59 0.28
60 0.28
61 0.27
62 0.25
63 0.19
64 0.1
65 0.08
66 0.07
67 0.09
68 0.09
69 0.09
70 0.12
71 0.19
72 0.24
73 0.27
74 0.27
75 0.28
76 0.28
77 0.32
78 0.38
79 0.33
80 0.29
81 0.3
82 0.28
83 0.27
84 0.26
85 0.21
86 0.12
87 0.11
88 0.16
89 0.16
90 0.26
91 0.29
92 0.36
93 0.37
94 0.44
95 0.48
96 0.48
97 0.5
98 0.43
99 0.43
100 0.39
101 0.38
102 0.32
103 0.28
104 0.23
105 0.16
106 0.13
107 0.08
108 0.04
109 0.04
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.07
118 0.07
119 0.09
120 0.11
121 0.12
122 0.14
123 0.15
124 0.17
125 0.16
126 0.25
127 0.34
128 0.42
129 0.52
130 0.6
131 0.69
132 0.77
133 0.84
134 0.85
135 0.86
136 0.86
137 0.87
138 0.85
139 0.82
140 0.75
141 0.67
142 0.62
143 0.54
144 0.5
145 0.43