Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S9A5

Protein Details
Accession A0A1Y1S9A5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
64-136KDKPPAQKPKKQEKPPAQKPKKQEKPKKQEKPKKQEKPKKQEKPKKQDKPKKQDKPKDKPKSGDKPKSGDKSKBasic
NLS Segment(s)
PositionSequence
63-156PKDKPPAQKPKKQEKPPAQKPKKQEKPKKQEKPKKQEKPKKQEKPKKQDKPKKQDKPKDKPKSGDKPKSGDKSKGKSGDKSKSADKSKSGDKSK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.833, mito_nucl 10.166, cyto 4, mito 3.5
Family & Domain DBs
Amino Acid Sequences MMVMLFWLYCILRVQCEEKNEKDKRTFLINLNEIDSSKSLLTQIYDKAIGLGFNFNKSNAAAPKDKPPAQKPKKQEKPPAQKPKKQEKPKKQEKPKKQEKPKKQEKPKKQDKPKKQDKPKDKPKSGDKPKSGDKSKGKSGDKSKSADKSKSGDKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.32
4 0.37
5 0.4
6 0.49
7 0.53
8 0.57
9 0.58
10 0.58
11 0.54
12 0.55
13 0.53
14 0.49
15 0.52
16 0.49
17 0.45
18 0.43
19 0.41
20 0.34
21 0.3
22 0.24
23 0.17
24 0.13
25 0.11
26 0.1
27 0.1
28 0.11
29 0.12
30 0.13
31 0.13
32 0.14
33 0.13
34 0.13
35 0.13
36 0.11
37 0.1
38 0.14
39 0.12
40 0.14
41 0.15
42 0.14
43 0.15
44 0.15
45 0.18
46 0.15
47 0.19
48 0.2
49 0.21
50 0.29
51 0.34
52 0.38
53 0.4
54 0.45
55 0.52
56 0.56
57 0.62
58 0.63
59 0.68
60 0.74
61 0.77
62 0.8
63 0.79
64 0.83
65 0.86
66 0.89
67 0.86
68 0.81
69 0.82
70 0.83
71 0.83
72 0.82
73 0.82
74 0.82
75 0.85
76 0.91
77 0.93
78 0.93
79 0.93
80 0.93
81 0.93
82 0.93
83 0.93
84 0.93
85 0.93
86 0.93
87 0.93
88 0.93
89 0.93
90 0.93
91 0.93
92 0.93
93 0.93
94 0.94
95 0.94
96 0.94
97 0.94
98 0.94
99 0.94
100 0.95
101 0.94
102 0.94
103 0.94
104 0.94
105 0.94
106 0.94
107 0.94
108 0.9
109 0.88
110 0.88
111 0.88
112 0.88
113 0.87
114 0.82
115 0.79
116 0.8
117 0.82
118 0.77
119 0.76
120 0.74
121 0.71
122 0.74
123 0.76
124 0.72
125 0.71
126 0.74
127 0.74
128 0.71
129 0.69
130 0.67
131 0.67
132 0.7
133 0.67
134 0.63
135 0.59
136 0.62