Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1S632

Protein Details
Accession A0A1Y1S632    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-74IVTSMNAKPKKKPQKKPKKDDEEBasic
NLS Segment(s)
PositionSequence
59-70KPKKKPQKKPKK
Subcellular Location(s) nucl 17.5, cyto_nucl 14.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MKIAVFLLQLVVAVEYEATDLNKISADNRSMLIKESNDIFNNSLFNTNGSFIVTSMNAKPKKKPQKKPKKDDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.05
5 0.05
6 0.05
7 0.06
8 0.06
9 0.07
10 0.07
11 0.08
12 0.11
13 0.12
14 0.12
15 0.13
16 0.14
17 0.14
18 0.15
19 0.16
20 0.13
21 0.13
22 0.13
23 0.15
24 0.14
25 0.15
26 0.14
27 0.12
28 0.13
29 0.12
30 0.12
31 0.1
32 0.1
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.08
39 0.09
40 0.09
41 0.1
42 0.13
43 0.21
44 0.27
45 0.29
46 0.36
47 0.46
48 0.57
49 0.65
50 0.73
51 0.76
52 0.82
53 0.91
54 0.95