Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1SAV8

Protein Details
Accession A0A1Y1SAV8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
34-61RLNSRMTKVVWKRKRRIRRSFLIHHLSTHydrophilic
NLS Segment(s)
PositionSequence
45-52KRKRRIRR
Subcellular Location(s) mito 22.5, mito_nucl 14, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MTTWKIFTIKLFIWLKISIKHIKENQQTYPCWIRLNSRMTKVVWKRKRRIRRSFLIHHLSTSRPCSICLKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.28
4 0.33
5 0.31
6 0.31
7 0.38
8 0.4
9 0.47
10 0.53
11 0.54
12 0.55
13 0.53
14 0.51
15 0.49
16 0.49
17 0.41
18 0.35
19 0.31
20 0.28
21 0.3
22 0.36
23 0.34
24 0.32
25 0.33
26 0.33
27 0.41
28 0.46
29 0.5
30 0.53
31 0.59
32 0.66
33 0.73
34 0.84
35 0.85
36 0.88
37 0.86
38 0.86
39 0.86
40 0.85
41 0.84
42 0.82
43 0.72
44 0.63
45 0.57
46 0.5
47 0.46
48 0.41
49 0.38
50 0.3
51 0.32