Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S905

Protein Details
Accession A0A1Y1S905   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-31LIHRGNTYKTKSNRRVRKVTPSKKVVNHydrophilic
NLS Segment(s)
PositionSequence
18-27RRVRKVTPSK
Subcellular Location(s) nucl 16.5, mito_nucl 14.333, mito 10, cyto_nucl 9.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
Amino Acid Sequences MKSVLIHRGNTYKTKSNRRVRKVTPSKKVVNVRVGKKGAMHRCHDCNQKITSIIQMRTAKFSRQKVSKRRVSRPLGATHCSKCVAKKITVDFFNNETRAVNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.72
4 0.79
5 0.81
6 0.85
7 0.82
8 0.85
9 0.85
10 0.85
11 0.84
12 0.81
13 0.78
14 0.77
15 0.78
16 0.73
17 0.71
18 0.69
19 0.63
20 0.63
21 0.59
22 0.51
23 0.47
24 0.49
25 0.48
26 0.45
27 0.45
28 0.42
29 0.46
30 0.51
31 0.54
32 0.49
33 0.44
34 0.4
35 0.37
36 0.33
37 0.29
38 0.29
39 0.25
40 0.24
41 0.27
42 0.29
43 0.28
44 0.32
45 0.33
46 0.32
47 0.35
48 0.4
49 0.4
50 0.45
51 0.54
52 0.59
53 0.67
54 0.72
55 0.74
56 0.77
57 0.8
58 0.78
59 0.77
60 0.72
61 0.71
62 0.67
63 0.62
64 0.58
65 0.51
66 0.47
67 0.41
68 0.37
69 0.32
70 0.35
71 0.37
72 0.36
73 0.41
74 0.45
75 0.5
76 0.54
77 0.55
78 0.49
79 0.48
80 0.5
81 0.44
82 0.37