Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S5X4

Protein Details
Accession A0A1Y1S5X4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
207-226EDTVEYKKYIKHKKSKKYLSHydrophilic
NLS Segment(s)
PositionSequence
219-220KK
Subcellular Location(s) cyto_nucl 14.5, nucl 13.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039907  NOB1  
IPR036283  NOB1_Zf-like_sf  
IPR014881  NOB1_Zn-bd  
IPR033411  Ribonuclease_PIN  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0004518  F:nuclease activity  
Pfam View protein in Pfam  
PF08772  NOB1_Zn_bind  
PF17146  PIN_6  
Amino Acid Sequences MLNNNQIAVIDTCAILKRVDVGTIDVYTTEGVDNELRDKESREIIGQKYVNLKVRNPSEESIRKIREFLIDKKSNLSCVDIELVALFYEIHREVEEENGQDEWITAENYRKIKNVVMHTDDNGIRGVLDGLGLQESGLSDKYYKYRCFTCFRIYEDDIDFCKSCGYKTITRVGFIIKNGTEVMCLKKGYEQKEKKICDKNGNEIGCEDTVEYKKYIKHKKSKKYLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.11
4 0.13
5 0.13
6 0.15
7 0.15
8 0.16
9 0.17
10 0.18
11 0.18
12 0.14
13 0.13
14 0.12
15 0.11
16 0.09
17 0.06
18 0.08
19 0.09
20 0.1
21 0.12
22 0.14
23 0.15
24 0.16
25 0.19
26 0.2
27 0.23
28 0.23
29 0.25
30 0.29
31 0.29
32 0.36
33 0.33
34 0.33
35 0.35
36 0.39
37 0.42
38 0.39
39 0.39
40 0.39
41 0.44
42 0.45
43 0.43
44 0.4
45 0.42
46 0.45
47 0.48
48 0.48
49 0.47
50 0.44
51 0.41
52 0.41
53 0.39
54 0.39
55 0.4
56 0.42
57 0.42
58 0.42
59 0.47
60 0.46
61 0.4
62 0.36
63 0.32
64 0.22
65 0.18
66 0.19
67 0.13
68 0.12
69 0.1
70 0.09
71 0.07
72 0.06
73 0.05
74 0.03
75 0.06
76 0.06
77 0.06
78 0.06
79 0.07
80 0.07
81 0.1
82 0.12
83 0.1
84 0.1
85 0.1
86 0.1
87 0.09
88 0.09
89 0.06
90 0.06
91 0.06
92 0.06
93 0.08
94 0.13
95 0.15
96 0.16
97 0.17
98 0.17
99 0.2
100 0.24
101 0.26
102 0.27
103 0.29
104 0.29
105 0.29
106 0.31
107 0.28
108 0.24
109 0.19
110 0.15
111 0.1
112 0.09
113 0.08
114 0.04
115 0.04
116 0.03
117 0.03
118 0.04
119 0.04
120 0.03
121 0.03
122 0.03
123 0.04
124 0.05
125 0.05
126 0.06
127 0.07
128 0.13
129 0.18
130 0.21
131 0.23
132 0.28
133 0.32
134 0.37
135 0.4
136 0.42
137 0.41
138 0.43
139 0.47
140 0.43
141 0.42
142 0.38
143 0.37
144 0.3
145 0.29
146 0.25
147 0.18
148 0.19
149 0.16
150 0.14
151 0.18
152 0.22
153 0.24
154 0.28
155 0.37
156 0.36
157 0.37
158 0.38
159 0.35
160 0.33
161 0.28
162 0.29
163 0.2
164 0.21
165 0.2
166 0.2
167 0.17
168 0.16
169 0.2
170 0.18
171 0.18
172 0.17
173 0.23
174 0.29
175 0.34
176 0.44
177 0.47
178 0.54
179 0.64
180 0.69
181 0.72
182 0.76
183 0.76
184 0.76
185 0.73
186 0.73
187 0.72
188 0.67
189 0.59
190 0.5
191 0.46
192 0.36
193 0.3
194 0.22
195 0.19
196 0.2
197 0.21
198 0.22
199 0.22
200 0.27
201 0.37
202 0.47
203 0.52
204 0.6
205 0.68
206 0.78