Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S5T6

Protein Details
Accession A0A1Y1S5T6   
Localization Confidence High
Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-29ILTKQSRIIRRKTKQIEEMKQSLKHydrophilic
39-64VKRRENKGEKEVKRRGRPRKIDLTKABasic
86-112LINNGNKPEKRKRGRPRKNSQLPDSNQHydrophilic
NLS Segment(s)
PositionSequence
15-58RRKTKQIEEMKQSLKERENKGEKEVKRRENKGEKEVKRRGRPRK
92-103KPEKRKRGRPRK
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MILLEILTKQSRIIRRKTKQIEEMKQSLKERENKGEKEVKRRENKGEKEVKRRGRPRKIDLTKADSIKTDLTKADSIRTNSTKADLINNGNKPEKRKRGRPRKNSQLPDSNQLPGTNTIKQPVEVSDRIEQTPKSELKPIAKIRIKPTTRFIDETDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.71
4 0.78
5 0.8
6 0.81
7 0.84
8 0.83
9 0.8
10 0.8
11 0.74
12 0.71
13 0.66
14 0.62
15 0.59
16 0.57
17 0.55
18 0.57
19 0.61
20 0.57
21 0.61
22 0.64
23 0.61
24 0.64
25 0.67
26 0.67
27 0.67
28 0.71
29 0.74
30 0.75
31 0.77
32 0.76
33 0.77
34 0.75
35 0.76
36 0.8
37 0.79
38 0.79
39 0.82
40 0.83
41 0.83
42 0.84
43 0.82
44 0.84
45 0.8
46 0.79
47 0.75
48 0.71
49 0.65
50 0.58
51 0.51
52 0.4
53 0.36
54 0.29
55 0.24
56 0.18
57 0.13
58 0.14
59 0.16
60 0.16
61 0.18
62 0.19
63 0.2
64 0.24
65 0.25
66 0.24
67 0.22
68 0.23
69 0.21
70 0.18
71 0.19
72 0.16
73 0.19
74 0.24
75 0.26
76 0.27
77 0.31
78 0.32
79 0.36
80 0.43
81 0.49
82 0.51
83 0.59
84 0.67
85 0.74
86 0.83
87 0.88
88 0.89
89 0.9
90 0.93
91 0.9
92 0.86
93 0.84
94 0.77
95 0.72
96 0.64
97 0.55
98 0.46
99 0.38
100 0.33
101 0.28
102 0.28
103 0.25
104 0.24
105 0.25
106 0.25
107 0.25
108 0.24
109 0.23
110 0.26
111 0.23
112 0.26
113 0.28
114 0.3
115 0.3
116 0.33
117 0.29
118 0.25
119 0.32
120 0.31
121 0.28
122 0.32
123 0.36
124 0.39
125 0.48
126 0.52
127 0.55
128 0.59
129 0.62
130 0.63
131 0.69
132 0.67
133 0.63
134 0.64
135 0.64
136 0.62
137 0.6