Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S4S0

Protein Details
Accession A0A1Y1S4S0   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MNKTKAVPETKERRRKKREKLAVAIDEIHydrophilic
NLS Segment(s)
PositionSequence
11-20KERRRKKREK
Subcellular Location(s) nucl 15, cyto_nucl 14.5, cyto 10
Family & Domain DBs
Amino Acid Sequences MNKTKAVPETKERRRKKREKLAVAIDEIHLNEEDMQNIKGLTNEENETNQDVLSDVDIAELSEIDESISVVDIPENSRICQAQLNSFVDLLAFYFNIFNTAYGSFYQTDLLIITRQVIKYKNILGEEEFANYMTVFLKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.91
3 0.92
4 0.93
5 0.93
6 0.92
7 0.91
8 0.9
9 0.83
10 0.75
11 0.65
12 0.54
13 0.44
14 0.34
15 0.26
16 0.17
17 0.13
18 0.11
19 0.1
20 0.11
21 0.11
22 0.11
23 0.1
24 0.1
25 0.09
26 0.09
27 0.1
28 0.11
29 0.12
30 0.13
31 0.14
32 0.15
33 0.16
34 0.16
35 0.15
36 0.13
37 0.11
38 0.1
39 0.08
40 0.08
41 0.06
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.05
61 0.09
62 0.1
63 0.1
64 0.11
65 0.12
66 0.12
67 0.15
68 0.15
69 0.15
70 0.19
71 0.21
72 0.2
73 0.2
74 0.19
75 0.16
76 0.15
77 0.11
78 0.06
79 0.05
80 0.04
81 0.05
82 0.05
83 0.07
84 0.07
85 0.07
86 0.08
87 0.08
88 0.09
89 0.09
90 0.12
91 0.11
92 0.12
93 0.12
94 0.1
95 0.1
96 0.09
97 0.1
98 0.08
99 0.08
100 0.1
101 0.12
102 0.14
103 0.17
104 0.2
105 0.21
106 0.26
107 0.3
108 0.33
109 0.31
110 0.32
111 0.31
112 0.31
113 0.29
114 0.27
115 0.22
116 0.18
117 0.17
118 0.14
119 0.13