Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S8L7

Protein Details
Accession A0A1Y1S8L7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
36-58IDAPNKRRVKKSRKCANCTCSRKHydrophilic
NLS Segment(s)
PositionSequence
42-46RRVKK
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007785  Anamorsin  
IPR046408  CIAPIN1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF05093  CIAPIN1  
Amino Acid Sequences MKNSKVTDDELEKLLKMAASKQNDPRERQIDEIDAIDAPNKRRVKKSRKCANCTCSRKSETAPKKSACGSCYLGDAFRCSGCPYKGMPSFKEGEEVDFNQDDLGNLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.18
3 0.14
4 0.18
5 0.23
6 0.28
7 0.34
8 0.42
9 0.51
10 0.55
11 0.59
12 0.61
13 0.59
14 0.55
15 0.52
16 0.46
17 0.38
18 0.34
19 0.29
20 0.22
21 0.16
22 0.14
23 0.14
24 0.14
25 0.14
26 0.21
27 0.24
28 0.26
29 0.35
30 0.45
31 0.54
32 0.61
33 0.7
34 0.72
35 0.78
36 0.83
37 0.83
38 0.81
39 0.8
40 0.77
41 0.7
42 0.66
43 0.59
44 0.54
45 0.49
46 0.51
47 0.5
48 0.52
49 0.55
50 0.49
51 0.49
52 0.51
53 0.51
54 0.41
55 0.37
56 0.31
57 0.25
58 0.26
59 0.25
60 0.21
61 0.19
62 0.2
63 0.16
64 0.13
65 0.13
66 0.13
67 0.18
68 0.17
69 0.19
70 0.19
71 0.27
72 0.33
73 0.37
74 0.37
75 0.36
76 0.39
77 0.37
78 0.4
79 0.32
80 0.29
81 0.3
82 0.3
83 0.3
84 0.27
85 0.27
86 0.22
87 0.22