Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S809

Protein Details
Accession A0A1Y1S809    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-99VVVNDKRKEKRSKERRRLKKRIRDYNQKILDEBasic
NLS Segment(s)
PositionSequence
73-89KRKEKRSKERRRLKKRI
Subcellular Location(s) nucl 16, cyto 4.5, cyto_mito 3.5, plas 2, mito 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHKIYKKKSETESSMELNAIDDVVEVDCVRPSLIPNELVDELNGIIRDIQNKQNGVGFRRNKEITISVVVNDKRKEKRSKERRRLKKRIRDYNQKILDEWNMQDELEYGNRNTFNRRMWMAVGLIIAMGSLMILGFMSMSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.44
3 0.36
4 0.28
5 0.22
6 0.15
7 0.09
8 0.06
9 0.06
10 0.06
11 0.06
12 0.05
13 0.06
14 0.06
15 0.07
16 0.07
17 0.07
18 0.08
19 0.1
20 0.13
21 0.14
22 0.14
23 0.17
24 0.18
25 0.18
26 0.16
27 0.14
28 0.12
29 0.11
30 0.11
31 0.07
32 0.07
33 0.07
34 0.1
35 0.12
36 0.17
37 0.2
38 0.21
39 0.21
40 0.24
41 0.25
42 0.27
43 0.33
44 0.32
45 0.31
46 0.37
47 0.37
48 0.34
49 0.34
50 0.31
51 0.25
52 0.23
53 0.21
54 0.15
55 0.19
56 0.21
57 0.22
58 0.22
59 0.26
60 0.28
61 0.35
62 0.43
63 0.47
64 0.57
65 0.64
66 0.74
67 0.79
68 0.85
69 0.89
70 0.92
71 0.94
72 0.94
73 0.93
74 0.92
75 0.93
76 0.91
77 0.91
78 0.88
79 0.87
80 0.84
81 0.74
82 0.64
83 0.55
84 0.49
85 0.4
86 0.33
87 0.25
88 0.18
89 0.17
90 0.16
91 0.14
92 0.12
93 0.12
94 0.13
95 0.11
96 0.14
97 0.17
98 0.18
99 0.23
100 0.25
101 0.27
102 0.3
103 0.32
104 0.31
105 0.3
106 0.31
107 0.27
108 0.24
109 0.2
110 0.15
111 0.12
112 0.1
113 0.08
114 0.05
115 0.04
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02