Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S6M8

Protein Details
Accession A0A1Y1S6M8   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
200-226VTPPKKSMSERTKKKIKYYITKAIKKCHydrophilic
NLS Segment(s)
PositionSequence
211-214TKKK
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
Amino Acid Sequences MVKELPPRKHNKIVTWADPIAETRLFVKEPSSEDMRDIPEDSEYYAYDDSEEYDTDDVLENGGMNQGSGVAQVTKEIVQEEEEQNIDQGIDQEAEEAFNESNLALYYVLIKNRVQLKVLEQNLDETKECLRTALVAHDELKADIDKKSMLLKECTAESERNRLMYVKAYETVSELTKYIQVRELAKAEDRVNPGMSNEPVTPPKKSMSERTKKKIKYYITKAIKKCGTKPVRVTIHRRNKAPCVLMLTRNEENKIXD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.6
4 0.51
5 0.46
6 0.4
7 0.34
8 0.26
9 0.21
10 0.16
11 0.18
12 0.18
13 0.17
14 0.18
15 0.17
16 0.21
17 0.25
18 0.28
19 0.25
20 0.27
21 0.3
22 0.3
23 0.28
24 0.26
25 0.22
26 0.19
27 0.19
28 0.18
29 0.16
30 0.14
31 0.15
32 0.14
33 0.13
34 0.12
35 0.11
36 0.12
37 0.12
38 0.12
39 0.1
40 0.1
41 0.1
42 0.1
43 0.11
44 0.08
45 0.07
46 0.07
47 0.06
48 0.06
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.05
58 0.05
59 0.05
60 0.07
61 0.07
62 0.07
63 0.08
64 0.08
65 0.09
66 0.13
67 0.14
68 0.14
69 0.14
70 0.14
71 0.13
72 0.13
73 0.11
74 0.07
75 0.07
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.07
82 0.06
83 0.07
84 0.06
85 0.05
86 0.06
87 0.05
88 0.05
89 0.05
90 0.05
91 0.04
92 0.04
93 0.07
94 0.09
95 0.1
96 0.11
97 0.11
98 0.15
99 0.2
100 0.21
101 0.19
102 0.18
103 0.22
104 0.28
105 0.3
106 0.27
107 0.22
108 0.24
109 0.24
110 0.25
111 0.2
112 0.13
113 0.13
114 0.13
115 0.13
116 0.1
117 0.09
118 0.08
119 0.09
120 0.11
121 0.11
122 0.1
123 0.11
124 0.12
125 0.12
126 0.12
127 0.12
128 0.1
129 0.09
130 0.09
131 0.09
132 0.08
133 0.08
134 0.12
135 0.14
136 0.15
137 0.17
138 0.17
139 0.18
140 0.18
141 0.2
142 0.19
143 0.2
144 0.2
145 0.25
146 0.25
147 0.24
148 0.25
149 0.23
150 0.22
151 0.23
152 0.24
153 0.19
154 0.2
155 0.19
156 0.19
157 0.19
158 0.2
159 0.15
160 0.13
161 0.11
162 0.1
163 0.14
164 0.14
165 0.14
166 0.17
167 0.18
168 0.2
169 0.23
170 0.24
171 0.22
172 0.24
173 0.27
174 0.24
175 0.27
176 0.28
177 0.27
178 0.26
179 0.24
180 0.23
181 0.24
182 0.23
183 0.2
184 0.18
185 0.2
186 0.25
187 0.27
188 0.28
189 0.26
190 0.3
191 0.33
192 0.36
193 0.43
194 0.48
195 0.56
196 0.64
197 0.71
198 0.78
199 0.76
200 0.81
201 0.79
202 0.78
203 0.78
204 0.77
205 0.78
206 0.79
207 0.83
208 0.77
209 0.78
210 0.76
211 0.7
212 0.67
213 0.67
214 0.64
215 0.63
216 0.67
217 0.67
218 0.7
219 0.73
220 0.76
221 0.76
222 0.8
223 0.79
224 0.79
225 0.75
226 0.73
227 0.74
228 0.68
229 0.61
230 0.58
231 0.55
232 0.55
233 0.54
234 0.53
235 0.51
236 0.51