Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S4C6

Protein Details
Accession A0A1Y1S4C6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
244-287LKTPPKTPPKTPPRTPPKTPPKPPRSPRRSSKKDKGDAKEKGTSBasic
NLS Segment(s)
PositionSequence
243-283PLKTPPKTPPKTPPRTPPKTPPKPPRSPRRSSKKDKGDAKE
Subcellular Location(s) nucl 7cyto 7cyto_nucl 7, golg 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLVNIFFGSYECAQAIEAAYKLGKRASYTFVKGSMDSFVLHNVLIKDTNISNLCVHWCDDDKPMNLEMYKVPPENSDPQTVLKGEIDNLFNPDYCPDEEIEVRELLLLQSEEDFDDAKKRAIAELEKTDYRNNFSDLPRQIWYQIYLYIKELKSEFCNLSIDDRKKAIIKVNMNQQAYWRITNLFDRADKEQRWKGSYMKAYLTFDHKGKGYKSDLFKLSRTKNTFTISNDEMKWLYVPGMKPLKTPPKTPPKTPPRTPPKTPPKPPRSPRRSSKKDKGDAKEKGTSYILRYIIRFALVALLIFLIYRCVRGSKNNNSEQPNTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.12
4 0.11
5 0.11
6 0.13
7 0.13
8 0.15
9 0.17
10 0.17
11 0.18
12 0.21
13 0.26
14 0.32
15 0.36
16 0.37
17 0.38
18 0.38
19 0.35
20 0.33
21 0.29
22 0.23
23 0.19
24 0.17
25 0.15
26 0.14
27 0.13
28 0.15
29 0.13
30 0.14
31 0.14
32 0.14
33 0.15
34 0.15
35 0.21
36 0.19
37 0.2
38 0.19
39 0.19
40 0.21
41 0.2
42 0.21
43 0.18
44 0.19
45 0.2
46 0.25
47 0.29
48 0.29
49 0.31
50 0.31
51 0.3
52 0.27
53 0.27
54 0.23
55 0.23
56 0.25
57 0.23
58 0.23
59 0.22
60 0.27
61 0.33
62 0.33
63 0.31
64 0.28
65 0.29
66 0.31
67 0.29
68 0.26
69 0.2
70 0.18
71 0.16
72 0.18
73 0.18
74 0.16
75 0.18
76 0.17
77 0.16
78 0.16
79 0.15
80 0.14
81 0.13
82 0.13
83 0.11
84 0.13
85 0.14
86 0.15
87 0.17
88 0.14
89 0.13
90 0.12
91 0.11
92 0.09
93 0.09
94 0.07
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.07
101 0.06
102 0.1
103 0.11
104 0.11
105 0.12
106 0.12
107 0.13
108 0.16
109 0.18
110 0.19
111 0.23
112 0.26
113 0.27
114 0.28
115 0.3
116 0.28
117 0.29
118 0.26
119 0.23
120 0.24
121 0.24
122 0.3
123 0.29
124 0.31
125 0.29
126 0.28
127 0.27
128 0.23
129 0.23
130 0.16
131 0.18
132 0.16
133 0.16
134 0.17
135 0.21
136 0.2
137 0.2
138 0.2
139 0.17
140 0.17
141 0.2
142 0.19
143 0.14
144 0.15
145 0.14
146 0.18
147 0.24
148 0.24
149 0.23
150 0.23
151 0.23
152 0.24
153 0.25
154 0.26
155 0.26
156 0.28
157 0.31
158 0.4
159 0.45
160 0.44
161 0.42
162 0.37
163 0.36
164 0.33
165 0.29
166 0.21
167 0.16
168 0.16
169 0.19
170 0.19
171 0.16
172 0.15
173 0.17
174 0.21
175 0.27
176 0.27
177 0.32
178 0.34
179 0.36
180 0.37
181 0.37
182 0.35
183 0.37
184 0.4
185 0.36
186 0.35
187 0.34
188 0.33
189 0.33
190 0.34
191 0.3
192 0.26
193 0.25
194 0.23
195 0.23
196 0.22
197 0.26
198 0.26
199 0.29
200 0.32
201 0.36
202 0.4
203 0.39
204 0.42
205 0.45
206 0.47
207 0.5
208 0.5
209 0.47
210 0.47
211 0.48
212 0.48
213 0.42
214 0.42
215 0.36
216 0.36
217 0.33
218 0.3
219 0.27
220 0.23
221 0.21
222 0.15
223 0.14
224 0.13
225 0.14
226 0.2
227 0.27
228 0.27
229 0.28
230 0.36
231 0.45
232 0.45
233 0.49
234 0.5
235 0.55
236 0.6
237 0.65
238 0.67
239 0.67
240 0.74
241 0.77
242 0.78
243 0.77
244 0.81
245 0.81
246 0.81
247 0.82
248 0.83
249 0.86
250 0.87
251 0.86
252 0.89
253 0.91
254 0.92
255 0.9
256 0.89
257 0.89
258 0.89
259 0.89
260 0.89
261 0.9
262 0.89
263 0.9
264 0.9
265 0.88
266 0.87
267 0.85
268 0.81
269 0.78
270 0.68
271 0.62
272 0.56
273 0.49
274 0.43
275 0.42
276 0.39
277 0.33
278 0.33
279 0.32
280 0.3
281 0.28
282 0.24
283 0.17
284 0.16
285 0.14
286 0.13
287 0.1
288 0.09
289 0.08
290 0.08
291 0.08
292 0.09
293 0.09
294 0.1
295 0.11
296 0.15
297 0.17
298 0.28
299 0.37
300 0.44
301 0.54
302 0.62
303 0.69
304 0.72