Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1S6G6

Protein Details
Accession A0A1Y1S6G6    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
196-222VTPPKKSMSERTKKKIKYYITKAIKKCHydrophilic
NLS Segment(s)
PositionSequence
207-210TKKK
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MVKELPPRKHNKIVTWADPIAETRLFVKEPSSEDMRDIPEDSEYYAYDDSEEYDTDDVLENGGINQGSGVAQVTKEIVQEEEEQNIDQEAEEAFNESNLALYYVLIKNRVQLKVLEQNLEETKESLRTALVAHDELKADIDKKSMLLKECTTESERNRLMYVKAYETVSELTKYIQVRELAKAEDRVNPGMSNEPVTPPKKSMSERTKKKIKYYITKAIKKCGTKPVRVTIHRRNKAPCVLMLTRNEENXI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.6
4 0.51
5 0.46
6 0.4
7 0.34
8 0.26
9 0.21
10 0.15
11 0.18
12 0.18
13 0.17
14 0.18
15 0.17
16 0.2
17 0.25
18 0.27
19 0.25
20 0.26
21 0.29
22 0.3
23 0.28
24 0.26
25 0.22
26 0.19
27 0.19
28 0.18
29 0.16
30 0.14
31 0.15
32 0.13
33 0.13
34 0.12
35 0.11
36 0.12
37 0.12
38 0.12
39 0.1
40 0.1
41 0.1
42 0.1
43 0.11
44 0.08
45 0.07
46 0.07
47 0.06
48 0.06
49 0.07
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.05
58 0.05
59 0.05
60 0.06
61 0.07
62 0.07
63 0.08
64 0.07
65 0.09
66 0.13
67 0.14
68 0.14
69 0.14
70 0.14
71 0.13
72 0.13
73 0.11
74 0.07
75 0.06
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.07
90 0.09
91 0.1
92 0.12
93 0.12
94 0.15
95 0.21
96 0.21
97 0.19
98 0.18
99 0.23
100 0.29
101 0.3
102 0.27
103 0.22
104 0.24
105 0.24
106 0.25
107 0.2
108 0.13
109 0.12
110 0.12
111 0.12
112 0.09
113 0.08
114 0.07
115 0.07
116 0.08
117 0.08
118 0.08
119 0.09
120 0.09
121 0.1
122 0.09
123 0.1
124 0.09
125 0.09
126 0.08
127 0.08
128 0.08
129 0.08
130 0.12
131 0.14
132 0.15
133 0.17
134 0.18
135 0.19
136 0.2
137 0.22
138 0.23
139 0.26
140 0.25
141 0.31
142 0.31
143 0.3
144 0.3
145 0.29
146 0.25
147 0.26
148 0.26
149 0.2
150 0.21
151 0.2
152 0.19
153 0.19
154 0.2
155 0.15
156 0.13
157 0.11
158 0.1
159 0.14
160 0.14
161 0.14
162 0.17
163 0.18
164 0.2
165 0.23
166 0.24
167 0.22
168 0.24
169 0.27
170 0.24
171 0.27
172 0.28
173 0.27
174 0.26
175 0.24
176 0.23
177 0.24
178 0.23
179 0.2
180 0.18
181 0.2
182 0.25
183 0.27
184 0.29
185 0.27
186 0.3
187 0.33
188 0.37
189 0.43
190 0.48
191 0.56
192 0.64
193 0.72
194 0.78
195 0.76
196 0.81
197 0.79
198 0.78
199 0.78
200 0.77
201 0.78
202 0.79
203 0.83
204 0.77
205 0.78
206 0.76
207 0.7
208 0.67
209 0.67
210 0.64
211 0.64
212 0.67
213 0.68
214 0.7
215 0.73
216 0.76
217 0.77
218 0.8
219 0.79
220 0.79
221 0.76
222 0.74
223 0.74
224 0.68
225 0.61
226 0.58
227 0.56
228 0.56
229 0.54
230 0.53