Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1S4Z9

Protein Details
Accession A0A1Y1S4Z9    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-86SKQTDEQKPREKVKRKNSMDGWRPTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
Amino Acid Sequences MYPNEYFNNGELTRIIREYWMGMHLYWITLLTKPIVKETNPSEGNKNSVKTNEENKPDQGSKQTDEQKPREKVKRKNSMDGWRPTFSEQSNIDVKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.13
4 0.14
5 0.14
6 0.14
7 0.14
8 0.12
9 0.11
10 0.13
11 0.12
12 0.12
13 0.11
14 0.1
15 0.09
16 0.09
17 0.09
18 0.09
19 0.11
20 0.11
21 0.15
22 0.16
23 0.16
24 0.19
25 0.22
26 0.29
27 0.29
28 0.3
29 0.3
30 0.29
31 0.33
32 0.31
33 0.29
34 0.22
35 0.22
36 0.23
37 0.23
38 0.29
39 0.31
40 0.33
41 0.34
42 0.35
43 0.38
44 0.36
45 0.34
46 0.33
47 0.3
48 0.28
49 0.33
50 0.4
51 0.41
52 0.48
53 0.54
54 0.58
55 0.61
56 0.68
57 0.71
58 0.72
59 0.76
60 0.79
61 0.83
62 0.79
63 0.82
64 0.82
65 0.82
66 0.82
67 0.81
68 0.76
69 0.68
70 0.64
71 0.57
72 0.53
73 0.44
74 0.42
75 0.34
76 0.33