Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S6G8

Protein Details
Accession A0A1Y1S6G8    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-23KGTPSMGKRTKRNHLLCPRCGHydrophilic
37-74CAYPEAKKRTRRSEKAKRREHGKKKYIKKVIQKSKTGFBasic
NLS Segment(s)
PositionSequence
42-71AKKRTRRSEKAKRREHGKKKYIKKVIQKSK
Subcellular Location(s) nucl 14, mito 8, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR018267  Ribosomal_L37e_CS  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
PROSITE View protein in PROSITE  
PS01077  RIBOSOMAL_L37E  
Amino Acid Sequences MSKGTPSMGKRTKRNHLLCPRCGHMAYHKQRAECASCAYPEAKKRTRRSEKAKRREHGKKKYIKKVIQKSKTGFRQHPLIMKMQGRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.8
4 0.81
5 0.79
6 0.76
7 0.69
8 0.62
9 0.56
10 0.47
11 0.45
12 0.47
13 0.48
14 0.52
15 0.51
16 0.47
17 0.48
18 0.5
19 0.44
20 0.35
21 0.32
22 0.23
23 0.21
24 0.22
25 0.21
26 0.21
27 0.23
28 0.3
29 0.33
30 0.4
31 0.46
32 0.56
33 0.65
34 0.71
35 0.76
36 0.79
37 0.83
38 0.86
39 0.89
40 0.84
41 0.84
42 0.86
43 0.86
44 0.85
45 0.84
46 0.83
47 0.84
48 0.88
49 0.88
50 0.85
51 0.85
52 0.85
53 0.87
54 0.85
55 0.83
56 0.79
57 0.79
58 0.8
59 0.78
60 0.72
61 0.66
62 0.65
63 0.62
64 0.63
65 0.56
66 0.53
67 0.51