Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1S4H6

Protein Details
Accession A0A1Y1S4H6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
163-182RLLQETKNRSQDKKKLKSLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037241  E2F-DP_heterodim  
IPR003316  E2F_WHTH_DNA-bd_dom  
IPR038168  TF_DP_C_sf  
IPR014889  Transc_factor_DP_C  
IPR015648  Transcrpt_fac_DP  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005667  C:transcription regulator complex  
GO:0003677  F:DNA binding  
GO:0051726  P:regulation of cell cycle  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF08781  DP  
PF02319  E2F_TDP  
Amino Acid Sequences MFESDTLLSDAKKEGMKYITQSVYAILKEKKEATYQQIVQEINTTNMETKVRRIYDVLNVLRAVNVIGKNGKIYFLIEDKENVNKKIEERDRLLQMKEAFEFITTKNRHNRPLGADEKLYLPFMIVSTETCSEIHCDTNEERDYFLFRSNRPLKIHEDLDILRLLQETKNRSQDKKKLKSLFLGDFMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.25
4 0.28
5 0.34
6 0.32
7 0.3
8 0.3
9 0.27
10 0.27
11 0.25
12 0.27
13 0.22
14 0.22
15 0.25
16 0.27
17 0.27
18 0.3
19 0.33
20 0.34
21 0.4
22 0.41
23 0.41
24 0.43
25 0.41
26 0.36
27 0.36
28 0.3
29 0.24
30 0.22
31 0.18
32 0.15
33 0.17
34 0.19
35 0.16
36 0.19
37 0.24
38 0.24
39 0.25
40 0.25
41 0.25
42 0.29
43 0.37
44 0.34
45 0.28
46 0.28
47 0.27
48 0.25
49 0.23
50 0.16
51 0.11
52 0.11
53 0.1
54 0.11
55 0.11
56 0.13
57 0.13
58 0.13
59 0.1
60 0.1
61 0.1
62 0.11
63 0.12
64 0.11
65 0.12
66 0.13
67 0.19
68 0.21
69 0.2
70 0.21
71 0.2
72 0.21
73 0.29
74 0.33
75 0.31
76 0.32
77 0.35
78 0.39
79 0.4
80 0.39
81 0.34
82 0.3
83 0.27
84 0.23
85 0.2
86 0.14
87 0.12
88 0.13
89 0.1
90 0.18
91 0.18
92 0.22
93 0.31
94 0.34
95 0.38
96 0.4
97 0.43
98 0.38
99 0.45
100 0.44
101 0.38
102 0.35
103 0.31
104 0.3
105 0.27
106 0.22
107 0.14
108 0.11
109 0.08
110 0.08
111 0.08
112 0.06
113 0.06
114 0.09
115 0.1
116 0.11
117 0.1
118 0.11
119 0.12
120 0.13
121 0.15
122 0.12
123 0.15
124 0.15
125 0.22
126 0.24
127 0.22
128 0.22
129 0.21
130 0.24
131 0.21
132 0.27
133 0.25
134 0.22
135 0.33
136 0.37
137 0.43
138 0.43
139 0.46
140 0.45
141 0.48
142 0.49
143 0.41
144 0.4
145 0.34
146 0.33
147 0.3
148 0.24
149 0.18
150 0.17
151 0.16
152 0.14
153 0.19
154 0.23
155 0.3
156 0.4
157 0.45
158 0.52
159 0.61
160 0.68
161 0.73
162 0.78
163 0.8
164 0.79
165 0.78
166 0.79
167 0.76
168 0.73