Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S9F9

Protein Details
Accession A0A1Y1S9F9   
Localization Confidence High
Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-21VNVPKEKKHYCRTCNTHTSNHydrophilic
51-77QTKPILRRKAKNTKKPVLKLKCTKCQHHydrophilic
NLS Segment(s)
PositionSequence
33-67PQREGNRRYRLKQKGFGGQTKPILRRKAKNTKKPV
Subcellular Location(s) nucl 22, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKEKKHYCRTCNTHTSNKISLYKKSRDNPQREGNRRYRLKQKGFGGQTKPILRRKAKNTKKPVLKLKCTKCQHVQMKPLHRAKQTIISNEKKVKGAALTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.79
4 0.79
5 0.75
6 0.74
7 0.67
8 0.65
9 0.64
10 0.57
11 0.59
12 0.56
13 0.56
14 0.58
15 0.6
16 0.64
17 0.66
18 0.69
19 0.69
20 0.71
21 0.75
22 0.74
23 0.77
24 0.75
25 0.75
26 0.74
27 0.71
28 0.71
29 0.71
30 0.69
31 0.68
32 0.63
33 0.62
34 0.61
35 0.62
36 0.55
37 0.49
38 0.48
39 0.45
40 0.47
41 0.43
42 0.47
43 0.46
44 0.5
45 0.56
46 0.62
47 0.67
48 0.72
49 0.76
50 0.78
51 0.81
52 0.82
53 0.83
54 0.81
55 0.81
56 0.81
57 0.79
58 0.8
59 0.76
60 0.74
61 0.71
62 0.72
63 0.72
64 0.69
65 0.7
66 0.69
67 0.74
68 0.77
69 0.77
70 0.74
71 0.68
72 0.63
73 0.58
74 0.59
75 0.55
76 0.54
77 0.55
78 0.55
79 0.6
80 0.64
81 0.64
82 0.56
83 0.51
84 0.45