Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1S8A3

Protein Details
Accession A0A1Y1S8A3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
96-119KATRCRKASCGHSNKLRPKKMKKKBasic
NLS Segment(s)
PositionSequence
110-119KLRPKKMKKK
Subcellular Location(s) nucl 19, cyto_nucl 12.333, mito_nucl 11.833, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038587  L40e_sf  
IPR001975  Ribosomal_L40e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01020  Ribosomal_L40e  
Amino Acid Sequences MEIFVKTHRNTIAKQISKDATVQQLNDELEQAYGVHISSRFSRCMKVGDTFRNGEVVFGAPMLLGGGNMTEGNKLISLESHLIQICRICYARNSLKATRCRKASCGHSNKLRPKKMKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.49
4 0.46
5 0.47
6 0.4
7 0.37
8 0.33
9 0.31
10 0.25
11 0.28
12 0.27
13 0.25
14 0.22
15 0.15
16 0.12
17 0.12
18 0.1
19 0.06
20 0.06
21 0.05
22 0.06
23 0.06
24 0.08
25 0.12
26 0.15
27 0.18
28 0.19
29 0.21
30 0.21
31 0.23
32 0.24
33 0.25
34 0.28
35 0.3
36 0.33
37 0.32
38 0.31
39 0.3
40 0.28
41 0.22
42 0.17
43 0.12
44 0.08
45 0.06
46 0.06
47 0.04
48 0.04
49 0.04
50 0.03
51 0.02
52 0.02
53 0.02
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.07
65 0.09
66 0.09
67 0.11
68 0.12
69 0.12
70 0.13
71 0.14
72 0.12
73 0.13
74 0.13
75 0.12
76 0.13
77 0.22
78 0.28
79 0.34
80 0.4
81 0.44
82 0.51
83 0.6
84 0.66
85 0.65
86 0.65
87 0.62
88 0.6
89 0.61
90 0.63
91 0.65
92 0.66
93 0.67
94 0.7
95 0.76
96 0.83
97 0.86
98 0.86
99 0.85