Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1S4R0

Protein Details
Accession A0A1Y1S4R0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-59ESKNIAKPKIQKPKPKPKTTTHydrophilic
NLS Segment(s)
PositionSequence
39-56ESKNIAKPKIQKPKPKPK
Subcellular Location(s) E.R. 9, extr 8, cyto 6.5, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNSNKKTGAIIIIISLVAILLCVGVFLIAIYVFKDRKQESKNIAKPKIQKPKPKPKTTTVPVRKFLPLLQDNSITDIDGTFAFLKASDTDXLELLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.06
4 0.04
5 0.03
6 0.03
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.03
16 0.03
17 0.04
18 0.07
19 0.08
20 0.09
21 0.15
22 0.16
23 0.24
24 0.27
25 0.33
26 0.38
27 0.48
28 0.55
29 0.58
30 0.61
31 0.59
32 0.64
33 0.67
34 0.7
35 0.66
36 0.69
37 0.7
38 0.78
39 0.83
40 0.84
41 0.79
42 0.76
43 0.78
44 0.75
45 0.76
46 0.75
47 0.73
48 0.67
49 0.65
50 0.59
51 0.5
52 0.44
53 0.42
54 0.36
55 0.32
56 0.31
57 0.3
58 0.29
59 0.31
60 0.3
61 0.21
62 0.17
63 0.13
64 0.11
65 0.09
66 0.11
67 0.08
68 0.08
69 0.08
70 0.08
71 0.1
72 0.09
73 0.12
74 0.1
75 0.11
76 0.12