Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S737

Protein Details
Accession A0A1Y1S737   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
196-218VILNILKKKKRRVKSNGIYEVFKHydrophilic
NLS Segment(s)
PositionSequence
202-208KKKKRRV
Subcellular Location(s) nucl 14.5cyto_nucl 14.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
Amino Acid Sequences MPQIKRVVDENYPNEDNTVGGVAARIKRFLKDKKSEQLLIVGPDPHVIEECLSKILDKICSKSAEYKAIYVTQKKDSNPEKKFFILDLNLSTSMQNQSLLYYYLELSLKHNCFVCLTSTSVQCLNTFEKRVRSRFKHKIFVLGYEENKEADDELAHYKEHKSLKQDTEIFEFHKKYKLEFYSVEFVCDLMEPLHFVILNILKKKKRRVKSNGIYEVFKEANVIELGCSDHMDVLYAYYDLMEFRLISDMGEILIDFCEYEEYVKANCAQFVRDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.29
4 0.21
5 0.17
6 0.09
7 0.08
8 0.09
9 0.13
10 0.18
11 0.19
12 0.22
13 0.22
14 0.27
15 0.36
16 0.44
17 0.5
18 0.55
19 0.62
20 0.68
21 0.74
22 0.72
23 0.65
24 0.61
25 0.54
26 0.47
27 0.41
28 0.32
29 0.24
30 0.23
31 0.22
32 0.16
33 0.14
34 0.12
35 0.1
36 0.11
37 0.11
38 0.12
39 0.11
40 0.11
41 0.12
42 0.15
43 0.21
44 0.22
45 0.24
46 0.27
47 0.3
48 0.32
49 0.37
50 0.39
51 0.39
52 0.38
53 0.36
54 0.34
55 0.38
56 0.4
57 0.38
58 0.37
59 0.37
60 0.41
61 0.4
62 0.47
63 0.5
64 0.56
65 0.57
66 0.57
67 0.53
68 0.5
69 0.5
70 0.42
71 0.37
72 0.29
73 0.24
74 0.22
75 0.21
76 0.2
77 0.19
78 0.18
79 0.15
80 0.15
81 0.13
82 0.12
83 0.09
84 0.09
85 0.1
86 0.11
87 0.09
88 0.09
89 0.08
90 0.1
91 0.11
92 0.1
93 0.12
94 0.17
95 0.18
96 0.18
97 0.19
98 0.17
99 0.17
100 0.17
101 0.17
102 0.12
103 0.14
104 0.15
105 0.15
106 0.16
107 0.17
108 0.17
109 0.15
110 0.16
111 0.16
112 0.17
113 0.19
114 0.2
115 0.27
116 0.31
117 0.37
118 0.43
119 0.46
120 0.54
121 0.62
122 0.66
123 0.66
124 0.62
125 0.64
126 0.56
127 0.53
128 0.48
129 0.41
130 0.36
131 0.29
132 0.29
133 0.21
134 0.2
135 0.17
136 0.11
137 0.08
138 0.07
139 0.06
140 0.08
141 0.09
142 0.09
143 0.1
144 0.1
145 0.16
146 0.19
147 0.2
148 0.23
149 0.29
150 0.33
151 0.39
152 0.41
153 0.38
154 0.39
155 0.37
156 0.35
157 0.33
158 0.32
159 0.26
160 0.3
161 0.28
162 0.25
163 0.32
164 0.31
165 0.3
166 0.3
167 0.33
168 0.35
169 0.35
170 0.34
171 0.26
172 0.23
173 0.2
174 0.18
175 0.14
176 0.06
177 0.06
178 0.06
179 0.06
180 0.07
181 0.06
182 0.06
183 0.09
184 0.14
185 0.18
186 0.22
187 0.29
188 0.34
189 0.4
190 0.51
191 0.58
192 0.62
193 0.69
194 0.74
195 0.79
196 0.84
197 0.88
198 0.88
199 0.81
200 0.73
201 0.63
202 0.59
203 0.47
204 0.37
205 0.26
206 0.16
207 0.15
208 0.14
209 0.13
210 0.08
211 0.08
212 0.1
213 0.09
214 0.1
215 0.08
216 0.08
217 0.08
218 0.09
219 0.08
220 0.08
221 0.08
222 0.08
223 0.07
224 0.06
225 0.07
226 0.06
227 0.07
228 0.07
229 0.06
230 0.06
231 0.09
232 0.09
233 0.09
234 0.1
235 0.09
236 0.08
237 0.09
238 0.08
239 0.06
240 0.06
241 0.06
242 0.05
243 0.05
244 0.07
245 0.07
246 0.08
247 0.09
248 0.11
249 0.12
250 0.14
251 0.19
252 0.19
253 0.22
254 0.22
255 0.22