Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S6Q6

Protein Details
Accession A0A1Y1S6Q6    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
28-53TTTTITSALKQKKKRKELKYEITTSKHydrophilic
118-138VTKMNKVKEFNKKNKNFIVKIHydrophilic
NLS Segment(s)
PositionSequence
39-43KKKRK
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036980  RNase_P/MRP_Rpp29_sf  
IPR023534  Rof/RNase_P-like  
Gene Ontology GO:0030677  C:ribonuclease P complex  
GO:0003723  F:RNA binding  
GO:0008033  P:tRNA processing  
Amino Acid Sequences MPNKFTCAYDRLLSKIKKNVPTSDLYYTTTTITSALKQKKKRKELKYEITTSKYADYLNLNRKTREYFNSVLKQGSNDYFMDQLSKTCLNGLIIEVKLTGKVTEGIIIHEGRNTVYFVTKMNKVKEFNKKNKNFIVKIENRRYLMIGSNLKHNRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.54
4 0.58
5 0.6
6 0.61
7 0.56
8 0.57
9 0.56
10 0.53
11 0.47
12 0.41
13 0.38
14 0.33
15 0.3
16 0.25
17 0.2
18 0.15
19 0.14
20 0.14
21 0.21
22 0.3
23 0.37
24 0.46
25 0.56
26 0.65
27 0.75
28 0.81
29 0.82
30 0.85
31 0.87
32 0.88
33 0.87
34 0.84
35 0.79
36 0.73
37 0.64
38 0.53
39 0.44
40 0.34
41 0.25
42 0.2
43 0.19
44 0.22
45 0.3
46 0.37
47 0.38
48 0.38
49 0.39
50 0.41
51 0.4
52 0.37
53 0.33
54 0.29
55 0.35
56 0.39
57 0.38
58 0.35
59 0.32
60 0.28
61 0.25
62 0.22
63 0.17
64 0.12
65 0.11
66 0.11
67 0.11
68 0.11
69 0.1
70 0.09
71 0.1
72 0.1
73 0.09
74 0.09
75 0.1
76 0.09
77 0.09
78 0.1
79 0.1
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.09
86 0.08
87 0.06
88 0.07
89 0.07
90 0.09
91 0.1
92 0.1
93 0.13
94 0.13
95 0.13
96 0.13
97 0.13
98 0.1
99 0.11
100 0.11
101 0.09
102 0.1
103 0.1
104 0.12
105 0.15
106 0.22
107 0.27
108 0.31
109 0.37
110 0.4
111 0.48
112 0.56
113 0.63
114 0.67
115 0.72
116 0.74
117 0.76
118 0.81
119 0.82
120 0.74
121 0.7
122 0.7
123 0.69
124 0.73
125 0.75
126 0.72
127 0.65
128 0.63
129 0.58
130 0.49
131 0.44
132 0.42
133 0.4
134 0.34
135 0.43