Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S4B8

Protein Details
Accession A0A1Y1S4B8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-100HEFEFEKKEKKEKKERLVGREBasic
NLS Segment(s)
PositionSequence
86-97KKEKKEKKERLV
Subcellular Location(s) mito 19, cyto 5.5, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MRRDAGSRYRDSSAEFARSLETRFETLIWPATQKWVYTEHNEPDIRVVGGTFNLAECRAVAERLFVQFGVVEEIQLGFEHEFEFEKKEKKEKKERLVGRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.27
4 0.27
5 0.28
6 0.26
7 0.23
8 0.2
9 0.17
10 0.17
11 0.18
12 0.16
13 0.16
14 0.19
15 0.16
16 0.16
17 0.15
18 0.19
19 0.19
20 0.18
21 0.18
22 0.2
23 0.22
24 0.25
25 0.29
26 0.27
27 0.32
28 0.32
29 0.3
30 0.26
31 0.24
32 0.2
33 0.15
34 0.12
35 0.06
36 0.06
37 0.06
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.06
45 0.07
46 0.07
47 0.07
48 0.08
49 0.1
50 0.11
51 0.11
52 0.09
53 0.09
54 0.08
55 0.09
56 0.11
57 0.1
58 0.09
59 0.08
60 0.09
61 0.09
62 0.08
63 0.1
64 0.05
65 0.06
66 0.06
67 0.07
68 0.08
69 0.09
70 0.14
71 0.16
72 0.24
73 0.27
74 0.38
75 0.46
76 0.54
77 0.65
78 0.71
79 0.78
80 0.81