Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S4N6

Protein Details
Accession A0A1Y1S4N6    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-29EEQRGRGRPRKYQPSYVFKAPHydrophilic
84-105AIKAVPTTKKKKKTARSDSTETHydrophilic
NLS Segment(s)
PositionSequence
83-97AAIKAVPTTKKKKKT
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MTNNNNPEEEQRGRGRPRKYQPSYVFKAPVYNSPLGYQYTLPIASNVNITLATAVPTTVRSRKQSTVVQSEEYILQPRTKRSAAIKAVPTTKKKKKTARSDSTETSTTNLTYESNTAELEDVYEKLLDRKDGQFLVKFRNRSFLHCDWVDENEIMXS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.63
4 0.7
5 0.75
6 0.75
7 0.78
8 0.78
9 0.8
10 0.8
11 0.76
12 0.7
13 0.59
14 0.58
15 0.49
16 0.46
17 0.42
18 0.38
19 0.32
20 0.29
21 0.31
22 0.26
23 0.26
24 0.2
25 0.15
26 0.15
27 0.14
28 0.13
29 0.12
30 0.12
31 0.11
32 0.11
33 0.1
34 0.09
35 0.08
36 0.08
37 0.07
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.07
44 0.1
45 0.15
46 0.19
47 0.22
48 0.27
49 0.3
50 0.35
51 0.38
52 0.41
53 0.43
54 0.41
55 0.38
56 0.33
57 0.31
58 0.27
59 0.23
60 0.19
61 0.13
62 0.14
63 0.14
64 0.15
65 0.19
66 0.18
67 0.2
68 0.21
69 0.29
70 0.3
71 0.34
72 0.36
73 0.36
74 0.42
75 0.45
76 0.47
77 0.49
78 0.53
79 0.57
80 0.62
81 0.69
82 0.72
83 0.79
84 0.83
85 0.83
86 0.83
87 0.8
88 0.75
89 0.7
90 0.61
91 0.5
92 0.41
93 0.32
94 0.24
95 0.18
96 0.14
97 0.1
98 0.09
99 0.1
100 0.1
101 0.1
102 0.09
103 0.09
104 0.09
105 0.08
106 0.09
107 0.09
108 0.08
109 0.08
110 0.09
111 0.09
112 0.11
113 0.13
114 0.14
115 0.17
116 0.19
117 0.23
118 0.25
119 0.28
120 0.31
121 0.32
122 0.4
123 0.43
124 0.45
125 0.42
126 0.49
127 0.47
128 0.47
129 0.52
130 0.47
131 0.48
132 0.44
133 0.47
134 0.4
135 0.42
136 0.4