Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S8Y4

Protein Details
Accession A0A1Y1S8Y4    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
54-76AENKTTLKSKRPRSKVRYCEICCHydrophilic
NLS Segment(s)
PositionSequence
50-67KKPRAENKTTLKSKRPRS
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006572  Znf_DBF  
IPR038545  Znf_DBF_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF07535  zf-DBF  
PROSITE View protein in PROSITE  
PS51265  ZF_DBF4  
Amino Acid Sequences MKSFRAFKFPYVYLEDTKGKCQPVYKEYAKKQPALNLNSAFLGCPFLPEKKPRAENKTTLKSKRPRSKVRYCEICCSKYDDYESHVSTALHRSFGDDNSNYKAIDAFVTEIRGTTFSQRHPRPSPCERLDNLYATAYLASSAHSVFKLCKFETFETEGITEEDVLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.4
4 0.43
5 0.42
6 0.38
7 0.36
8 0.39
9 0.4
10 0.38
11 0.45
12 0.49
13 0.55
14 0.59
15 0.67
16 0.66
17 0.63
18 0.61
19 0.59
20 0.59
21 0.54
22 0.54
23 0.45
24 0.42
25 0.38
26 0.35
27 0.28
28 0.19
29 0.18
30 0.11
31 0.12
32 0.12
33 0.15
34 0.2
35 0.25
36 0.29
37 0.34
38 0.43
39 0.48
40 0.54
41 0.57
42 0.61
43 0.66
44 0.71
45 0.71
46 0.69
47 0.7
48 0.7
49 0.75
50 0.76
51 0.77
52 0.77
53 0.78
54 0.83
55 0.83
56 0.83
57 0.83
58 0.76
59 0.76
60 0.71
61 0.64
62 0.54
63 0.51
64 0.43
65 0.34
66 0.33
67 0.24
68 0.22
69 0.24
70 0.24
71 0.18
72 0.18
73 0.16
74 0.15
75 0.2
76 0.17
77 0.14
78 0.13
79 0.15
80 0.16
81 0.17
82 0.2
83 0.16
84 0.18
85 0.2
86 0.21
87 0.19
88 0.17
89 0.17
90 0.12
91 0.11
92 0.1
93 0.08
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.1
100 0.1
101 0.14
102 0.17
103 0.21
104 0.32
105 0.35
106 0.43
107 0.48
108 0.54
109 0.57
110 0.62
111 0.66
112 0.61
113 0.65
114 0.58
115 0.58
116 0.55
117 0.5
118 0.43
119 0.34
120 0.29
121 0.22
122 0.2
123 0.13
124 0.1
125 0.07
126 0.07
127 0.07
128 0.08
129 0.09
130 0.09
131 0.1
132 0.13
133 0.18
134 0.23
135 0.23
136 0.28
137 0.33
138 0.35
139 0.4
140 0.43
141 0.38
142 0.35
143 0.34
144 0.3
145 0.25
146 0.23