Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1S8D9

Protein Details
Accession A0A1Y1S8D9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-28IPEKIRKSHREVFQAQKEKHBasic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006597  Sel1-like  
IPR011990  TPR-like_helical_dom_sf  
Pfam View protein in Pfam  
PF08238  Sel1  
Amino Acid Sequences MISDKYIVIPEKIRKSHREVFQAQKEKHIFGFLRKFLKWLEDDNKSYNKMVLFENPLKMNDNARYNKEFNQLIHDFLQNVIYKDYSDKKQGKRFKGEAHTFIGVGYEFGMFTLPKNAQKAYENYNVAAQLSNAMGTFKLAQCFEKGSGVSQSNETALSFYRCAAKLGLVDALHTYGMITYHGFVGSPKDQNTGYYYMKVAAKKADKLCPYPLYDLGLFYESGGNECGVSEDFVYALENFERGAQLGDPNCKFKLAQAYEFGDLKLKKNKSKSLELYKSAAESGSVEAQFYISECYLSGKTKQLNRNYFKSYKWAIQGAIKGHPSCAYKCGESAMTGTGTDANVLDALFWYEIAKVFGHGDADQKIKELNYKINKENVGPEWPEPCCCCLFGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.7
4 0.71
5 0.72
6 0.7
7 0.73
8 0.77
9 0.8
10 0.72
11 0.73
12 0.68
13 0.61
14 0.54
15 0.52
16 0.43
17 0.42
18 0.51
19 0.47
20 0.51
21 0.48
22 0.49
23 0.43
24 0.47
25 0.41
26 0.4
27 0.41
28 0.42
29 0.46
30 0.5
31 0.54
32 0.51
33 0.49
34 0.43
35 0.37
36 0.31
37 0.3
38 0.3
39 0.32
40 0.34
41 0.38
42 0.37
43 0.37
44 0.39
45 0.38
46 0.37
47 0.35
48 0.39
49 0.4
50 0.43
51 0.48
52 0.48
53 0.51
54 0.53
55 0.5
56 0.42
57 0.45
58 0.4
59 0.37
60 0.36
61 0.32
62 0.26
63 0.23
64 0.27
65 0.21
66 0.21
67 0.19
68 0.16
69 0.16
70 0.2
71 0.26
72 0.25
73 0.32
74 0.4
75 0.47
76 0.56
77 0.65
78 0.69
79 0.72
80 0.74
81 0.73
82 0.75
83 0.74
84 0.68
85 0.63
86 0.56
87 0.46
88 0.4
89 0.32
90 0.21
91 0.15
92 0.11
93 0.06
94 0.05
95 0.05
96 0.06
97 0.05
98 0.06
99 0.11
100 0.13
101 0.16
102 0.18
103 0.19
104 0.21
105 0.25
106 0.28
107 0.3
108 0.35
109 0.33
110 0.32
111 0.32
112 0.3
113 0.26
114 0.23
115 0.16
116 0.09
117 0.08
118 0.08
119 0.06
120 0.06
121 0.06
122 0.06
123 0.09
124 0.08
125 0.11
126 0.11
127 0.12
128 0.13
129 0.15
130 0.16
131 0.16
132 0.15
133 0.14
134 0.17
135 0.18
136 0.18
137 0.17
138 0.17
139 0.14
140 0.15
141 0.13
142 0.09
143 0.09
144 0.1
145 0.09
146 0.09
147 0.13
148 0.13
149 0.14
150 0.14
151 0.14
152 0.12
153 0.13
154 0.15
155 0.11
156 0.11
157 0.1
158 0.1
159 0.08
160 0.08
161 0.06
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.05
171 0.09
172 0.12
173 0.14
174 0.14
175 0.15
176 0.16
177 0.17
178 0.19
179 0.2
180 0.18
181 0.16
182 0.16
183 0.17
184 0.2
185 0.2
186 0.18
187 0.19
188 0.21
189 0.25
190 0.29
191 0.32
192 0.32
193 0.34
194 0.37
195 0.35
196 0.35
197 0.31
198 0.29
199 0.25
200 0.23
201 0.2
202 0.16
203 0.14
204 0.11
205 0.1
206 0.1
207 0.07
208 0.08
209 0.08
210 0.07
211 0.06
212 0.06
213 0.07
214 0.05
215 0.06
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.05
222 0.06
223 0.05
224 0.05
225 0.05
226 0.06
227 0.06
228 0.05
229 0.06
230 0.06
231 0.09
232 0.12
233 0.18
234 0.19
235 0.22
236 0.22
237 0.22
238 0.21
239 0.21
240 0.29
241 0.26
242 0.27
243 0.29
244 0.31
245 0.33
246 0.33
247 0.31
248 0.26
249 0.24
250 0.26
251 0.3
252 0.33
253 0.36
254 0.43
255 0.5
256 0.51
257 0.59
258 0.63
259 0.66
260 0.68
261 0.65
262 0.61
263 0.54
264 0.48
265 0.39
266 0.3
267 0.2
268 0.13
269 0.11
270 0.13
271 0.12
272 0.11
273 0.11
274 0.11
275 0.11
276 0.1
277 0.11
278 0.07
279 0.07
280 0.07
281 0.1
282 0.12
283 0.14
284 0.16
285 0.2
286 0.26
287 0.34
288 0.42
289 0.49
290 0.57
291 0.61
292 0.66
293 0.68
294 0.65
295 0.59
296 0.59
297 0.54
298 0.49
299 0.47
300 0.43
301 0.38
302 0.39
303 0.42
304 0.37
305 0.38
306 0.37
307 0.32
308 0.31
309 0.33
310 0.31
311 0.28
312 0.3
313 0.28
314 0.25
315 0.25
316 0.27
317 0.23
318 0.21
319 0.21
320 0.19
321 0.16
322 0.15
323 0.14
324 0.13
325 0.12
326 0.12
327 0.1
328 0.08
329 0.08
330 0.08
331 0.07
332 0.06
333 0.08
334 0.07
335 0.07
336 0.07
337 0.08
338 0.09
339 0.11
340 0.11
341 0.1
342 0.11
343 0.12
344 0.14
345 0.14
346 0.17
347 0.19
348 0.22
349 0.21
350 0.21
351 0.22
352 0.21
353 0.27
354 0.27
355 0.33
356 0.4
357 0.47
358 0.51
359 0.57
360 0.58
361 0.54
362 0.56
363 0.51
364 0.48
365 0.44
366 0.42
367 0.4
368 0.39
369 0.41
370 0.36
371 0.36
372 0.31