Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S807

Protein Details
Accession A0A1Y1S807    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
129-152LPSLYKPVEKYKPRFDHKKFVLECHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 11, mito 4, plas 3, golg 3, cyto_mito 3, cyto 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018624  Sec66  
Gene Ontology GO:0031207  C:Sec62/Sec63 complex  
GO:0031204  P:post-translational protein targeting to membrane, translocation  
Pfam View protein in Pfam  
PF09802  Sec66  
Amino Acid Sequences MFIVIVSLLVACFIVLYTIRIKKEKESMETTNPEFLKYIEEFYYEKPNKKKAQLLRAAKYLTEVSEALREEESSADRLYKKGLLSDEYMNKLHMKMEEEIFVEKHLIQREAEEIKPGFSSTIFGEAAYLPSLYKPVEKYKPRFDHKKFVLECEKLSKGTVHKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.14
5 0.19
6 0.23
7 0.27
8 0.29
9 0.33
10 0.41
11 0.45
12 0.45
13 0.47
14 0.49
15 0.53
16 0.56
17 0.53
18 0.51
19 0.46
20 0.4
21 0.33
22 0.28
23 0.25
24 0.2
25 0.21
26 0.15
27 0.17
28 0.17
29 0.19
30 0.3
31 0.29
32 0.35
33 0.38
34 0.46
35 0.5
36 0.54
37 0.6
38 0.57
39 0.63
40 0.66
41 0.69
42 0.65
43 0.64
44 0.59
45 0.51
46 0.45
47 0.35
48 0.26
49 0.19
50 0.15
51 0.11
52 0.13
53 0.13
54 0.12
55 0.12
56 0.11
57 0.1
58 0.1
59 0.11
60 0.09
61 0.09
62 0.1
63 0.1
64 0.11
65 0.11
66 0.13
67 0.12
68 0.13
69 0.14
70 0.14
71 0.16
72 0.19
73 0.21
74 0.21
75 0.21
76 0.2
77 0.19
78 0.17
79 0.16
80 0.14
81 0.14
82 0.13
83 0.14
84 0.15
85 0.15
86 0.16
87 0.15
88 0.14
89 0.12
90 0.1
91 0.13
92 0.13
93 0.14
94 0.13
95 0.13
96 0.17
97 0.19
98 0.19
99 0.2
100 0.18
101 0.18
102 0.18
103 0.17
104 0.14
105 0.1
106 0.12
107 0.08
108 0.12
109 0.11
110 0.11
111 0.11
112 0.11
113 0.12
114 0.11
115 0.11
116 0.07
117 0.07
118 0.09
119 0.09
120 0.12
121 0.14
122 0.22
123 0.32
124 0.41
125 0.48
126 0.58
127 0.67
128 0.73
129 0.81
130 0.79
131 0.8
132 0.77
133 0.8
134 0.71
135 0.7
136 0.7
137 0.62
138 0.59
139 0.56
140 0.52
141 0.43
142 0.43
143 0.39
144 0.34