Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1S6U5

Protein Details
Accession A0A1Y1S6U5    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKKFLRNKRVKHEVKPIKVDRBasic
NLS Segment(s)
PositionSequence
7-19NKRVKHEVKPIKV
Subcellular Location(s) nucl 19, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MKKFLRNKRVKHEVKPIKVDRIIKKKTYELSESQKIAKMIAAEVCGLQPYEKKAIEYIKSDNTKKARKFLKIRLGSLTRAEKKFEQLMKLVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.77
4 0.74
5 0.73
6 0.72
7 0.71
8 0.71
9 0.69
10 0.64
11 0.63
12 0.6
13 0.59
14 0.56
15 0.51
16 0.47
17 0.49
18 0.5
19 0.47
20 0.43
21 0.41
22 0.36
23 0.31
24 0.25
25 0.18
26 0.13
27 0.12
28 0.11
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.06
35 0.06
36 0.08
37 0.12
38 0.12
39 0.13
40 0.15
41 0.19
42 0.22
43 0.24
44 0.25
45 0.29
46 0.34
47 0.35
48 0.4
49 0.43
50 0.49
51 0.49
52 0.54
53 0.54
54 0.58
55 0.65
56 0.68
57 0.71
58 0.69
59 0.69
60 0.68
61 0.64
62 0.57
63 0.56
64 0.56
65 0.53
66 0.48
67 0.51
68 0.45
69 0.47
70 0.53
71 0.5
72 0.45