Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y1S5B1

Protein Details
Accession A0A1Y1S5B1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
36-56VESRTKKVIRKPDKKRGFVNWHydrophilic
NLS Segment(s)
PositionSequence
41-51KKVIRKPDKKR
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSEIEQQMEEKNVPIPFVDNIQPSCDIPLLFKIRDVESRTKKVIRKPDKKRGFVNWLMKTCTCSGISDEEVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.14
4 0.17
5 0.19
6 0.18
7 0.18
8 0.2
9 0.21
10 0.19
11 0.19
12 0.17
13 0.14
14 0.11
15 0.17
16 0.18
17 0.17
18 0.18
19 0.19
20 0.19
21 0.24
22 0.27
23 0.3
24 0.33
25 0.37
26 0.39
27 0.43
28 0.46
29 0.48
30 0.55
31 0.57
32 0.62
33 0.68
34 0.76
35 0.8
36 0.81
37 0.81
38 0.78
39 0.75
40 0.74
41 0.74
42 0.71
43 0.65
44 0.63
45 0.58
46 0.53
47 0.46
48 0.4
49 0.31
50 0.24
51 0.23
52 0.24