Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S5Y9

Protein Details
Accession A0A1Y1S5Y9   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKECTYSKCPQAKKRKKWLDGFVKQVRGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018838  DUF2439  
Pfam View protein in Pfam  
PF10382  DUF2439  
Amino Acid Sequences MKECTYSKCPQAKKRKKWLDGFVKQVRGKMRLFDSNKKVIYESEKYFIDKDDSLRMSVFTVEVDDYTFMSKDLVESEVTERVRETPKEFQVEKDVLKIEKKMKNENRGKMNMGRSNAEILELIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.89
4 0.89
5 0.9
6 0.89
7 0.85
8 0.85
9 0.8
10 0.79
11 0.71
12 0.66
13 0.6
14 0.53
15 0.47
16 0.42
17 0.39
18 0.4
19 0.45
20 0.5
21 0.51
22 0.54
23 0.55
24 0.5
25 0.46
26 0.39
27 0.39
28 0.36
29 0.32
30 0.29
31 0.28
32 0.28
33 0.28
34 0.27
35 0.23
36 0.18
37 0.17
38 0.19
39 0.19
40 0.19
41 0.18
42 0.18
43 0.15
44 0.14
45 0.12
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.07
61 0.06
62 0.07
63 0.09
64 0.13
65 0.14
66 0.14
67 0.13
68 0.15
69 0.2
70 0.21
71 0.24
72 0.27
73 0.31
74 0.38
75 0.38
76 0.37
77 0.39
78 0.41
79 0.37
80 0.32
81 0.3
82 0.26
83 0.28
84 0.31
85 0.33
86 0.35
87 0.39
88 0.47
89 0.53
90 0.62
91 0.68
92 0.71
93 0.72
94 0.71
95 0.72
96 0.68
97 0.69
98 0.64
99 0.58
100 0.53
101 0.46
102 0.44
103 0.39
104 0.33
105 0.24