Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S5T8

Protein Details
Accession A0A1Y1S5T8    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
93-124TGEEKTKVLRKQRKEARKKKAKIFGTMKRNMKBasic
NLS Segment(s)
PositionSequence
97-132KTKVLRKQRKEARKKKAKIFGTMKRNMKKIEKRNKD
Subcellular Location(s) nucl 21, mito_nucl 13.333, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MAIQLKVQKSFTNSLFSRKEIDLTIKHSKQATPNKNEIKKELSTNYSIPVEQIHVFDMTTGFGLHSTEAKAHLYSNAELMKKVVLDYVLRKLTGEEKTKVLRKQRKEARKKKAKIFGTMKRNMKKIEKRNKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.41
4 0.41
5 0.35
6 0.35
7 0.28
8 0.33
9 0.28
10 0.33
11 0.41
12 0.37
13 0.4
14 0.4
15 0.41
16 0.44
17 0.51
18 0.54
19 0.51
20 0.59
21 0.66
22 0.7
23 0.7
24 0.64
25 0.59
26 0.52
27 0.49
28 0.44
29 0.37
30 0.34
31 0.32
32 0.31
33 0.27
34 0.24
35 0.2
36 0.16
37 0.15
38 0.12
39 0.12
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.06
46 0.06
47 0.05
48 0.04
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.07
57 0.07
58 0.07
59 0.09
60 0.1
61 0.1
62 0.13
63 0.15
64 0.14
65 0.14
66 0.14
67 0.13
68 0.11
69 0.11
70 0.09
71 0.07
72 0.08
73 0.11
74 0.17
75 0.18
76 0.18
77 0.18
78 0.18
79 0.23
80 0.28
81 0.31
82 0.27
83 0.3
84 0.36
85 0.43
86 0.48
87 0.52
88 0.55
89 0.57
90 0.66
91 0.72
92 0.77
93 0.82
94 0.87
95 0.87
96 0.89
97 0.9
98 0.9
99 0.89
100 0.84
101 0.83
102 0.82
103 0.8
104 0.8
105 0.8
106 0.8
107 0.77
108 0.77
109 0.73
110 0.74
111 0.75
112 0.76