Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S6M0

Protein Details
Accession A0A1Y1S6M0    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-76FQNQKKQHHHYQDGHKEKRKVIHHRRSNLTNKLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 11, cyto 4, mito 3.5
Family & Domain DBs
Amino Acid Sequences MIKTALYVLLNLFVLASEEKKESEPGKVEPSEEPSTSEKLQQFQNQKKQHHHYQDGHKEKRKVIHHRRSNLTNKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.1
6 0.11
7 0.12
8 0.16
9 0.16
10 0.19
11 0.21
12 0.22
13 0.27
14 0.26
15 0.27
16 0.24
17 0.3
18 0.28
19 0.25
20 0.26
21 0.22
22 0.25
23 0.24
24 0.27
25 0.21
26 0.21
27 0.24
28 0.27
29 0.34
30 0.4
31 0.49
32 0.52
33 0.57
34 0.63
35 0.67
36 0.7
37 0.7
38 0.7
39 0.68
40 0.72
41 0.77
42 0.79
43 0.81
44 0.79
45 0.75
46 0.71
47 0.72
48 0.7
49 0.71
50 0.72
51 0.74
52 0.75
53 0.8
54 0.84
55 0.85
56 0.85