Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S419

Protein Details
Accession A0A1Y1S419    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-78EEVEGKKAVKHYKKYIKNRNLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR007109  Brix  
Gene Ontology GO:0019843  F:rRNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04427  Brix  
PROSITE View protein in PROSITE  
PS50833  BRIX  
Amino Acid Sequences MDLDANKVINCSVHKDFIYFRMFKFVLSLSEKKLKNTKTRMNEIGPQMTLRLYRFTEEVEGKKAVKHYKKYIKNRNLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.27
4 0.31
5 0.36
6 0.3
7 0.27
8 0.31
9 0.3
10 0.28
11 0.28
12 0.23
13 0.21
14 0.26
15 0.27
16 0.23
17 0.32
18 0.32
19 0.34
20 0.39
21 0.4
22 0.43
23 0.49
24 0.53
25 0.52
26 0.58
27 0.59
28 0.55
29 0.55
30 0.49
31 0.43
32 0.35
33 0.28
34 0.23
35 0.19
36 0.18
37 0.14
38 0.14
39 0.13
40 0.14
41 0.14
42 0.15
43 0.19
44 0.22
45 0.24
46 0.24
47 0.26
48 0.25
49 0.27
50 0.32
51 0.36
52 0.41
53 0.46
54 0.53
55 0.62
56 0.72
57 0.81
58 0.86