Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S7R6

Protein Details
Accession A0A1Y1S7R6   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-80HKIHVKARSKDKRYAKEKRVBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 12, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR003923  TFIID_30kDa  
Gene Ontology GO:0005634  C:nucleus  
GO:0006352  P:DNA-templated transcription initiation  
Pfam View protein in Pfam  
PF03540  TFIID_30kDa  
Amino Acid Sequences MKEEEFKERLSKYTPLLPESVIDHYLEKNGVKTDNESIRKTVSLMAHKFLTDIATNAYQFHKIHVKARSKDKRYAKEKRVTLQVPDVEKALEEMGIDISRPYYYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.34
3 0.34
4 0.31
5 0.28
6 0.27
7 0.26
8 0.19
9 0.17
10 0.16
11 0.15
12 0.16
13 0.16
14 0.14
15 0.13
16 0.14
17 0.15
18 0.15
19 0.17
20 0.22
21 0.29
22 0.33
23 0.32
24 0.32
25 0.31
26 0.3
27 0.29
28 0.26
29 0.22
30 0.25
31 0.25
32 0.25
33 0.25
34 0.24
35 0.24
36 0.19
37 0.17
38 0.09
39 0.08
40 0.08
41 0.09
42 0.09
43 0.1
44 0.11
45 0.12
46 0.12
47 0.14
48 0.18
49 0.19
50 0.25
51 0.32
52 0.4
53 0.43
54 0.54
55 0.62
56 0.61
57 0.69
58 0.73
59 0.75
60 0.76
61 0.8
62 0.79
63 0.78
64 0.78
65 0.74
66 0.74
67 0.66
68 0.61
69 0.58
70 0.54
71 0.48
72 0.43
73 0.38
74 0.28
75 0.26
76 0.23
77 0.16
78 0.11
79 0.07
80 0.07
81 0.09
82 0.09
83 0.09
84 0.08
85 0.09