Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S5S1

Protein Details
Accession A0A1Y1S5S1   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
73-102DVTAAKRLKQNKERDKRKENRTLLQNQKDLHydrophilic
NLS Segment(s)
PositionSequence
78-90KRLKQNKERDKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MFAAPAESPIEVEVNPRLNTETYDILVQMKQDLDEQITHLTTKIAISKKVIKKCNSEINKAKRIINKDKTPDDVTAAKRLKQNKERDKRKENRTLLQNQKDLTEVEANWLEQLIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.21
5 0.21
6 0.22
7 0.23
8 0.21
9 0.16
10 0.17
11 0.16
12 0.16
13 0.15
14 0.14
15 0.12
16 0.1
17 0.1
18 0.1
19 0.11
20 0.11
21 0.1
22 0.12
23 0.12
24 0.12
25 0.11
26 0.1
27 0.1
28 0.08
29 0.09
30 0.14
31 0.14
32 0.15
33 0.18
34 0.27
35 0.34
36 0.41
37 0.47
38 0.45
39 0.49
40 0.53
41 0.6
42 0.55
43 0.56
44 0.57
45 0.58
46 0.62
47 0.58
48 0.57
49 0.51
50 0.55
51 0.57
52 0.57
53 0.55
54 0.54
55 0.55
56 0.55
57 0.54
58 0.47
59 0.4
60 0.37
61 0.33
62 0.36
63 0.35
64 0.34
65 0.35
66 0.42
67 0.48
68 0.51
69 0.6
70 0.62
71 0.71
72 0.78
73 0.84
74 0.88
75 0.88
76 0.89
77 0.89
78 0.85
79 0.83
80 0.81
81 0.82
82 0.81
83 0.8
84 0.74
85 0.64
86 0.58
87 0.51
88 0.42
89 0.36
90 0.3
91 0.21
92 0.22
93 0.24
94 0.23
95 0.21