Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S4B9

Protein Details
Accession A0A1Y1S4B9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
91-112APLNKLTKGHKNEKIKNKNKNTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito_nucl 10.999, cyto_nucl 10.166, mito 9, cyto_mito 8.499, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
Amino Acid Sequences MDNIDNLERVFFRLQESKLKVNVKKCTFFTTSVKYLGRIISAEGLKPQPNKIEAVNKMSTSSKNNYSKRITVILGVTNYRKFIESYAWMAAPLNKLTKGHKNEKIKNKNKNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.34
3 0.39
4 0.41
5 0.46
6 0.54
7 0.54
8 0.56
9 0.63
10 0.6
11 0.61
12 0.57
13 0.57
14 0.52
15 0.51
16 0.49
17 0.46
18 0.42
19 0.42
20 0.4
21 0.35
22 0.33
23 0.29
24 0.24
25 0.17
26 0.15
27 0.14
28 0.14
29 0.14
30 0.14
31 0.15
32 0.18
33 0.19
34 0.19
35 0.17
36 0.18
37 0.19
38 0.19
39 0.24
40 0.24
41 0.28
42 0.28
43 0.25
44 0.26
45 0.26
46 0.25
47 0.22
48 0.24
49 0.27
50 0.35
51 0.37
52 0.42
53 0.44
54 0.45
55 0.43
56 0.43
57 0.34
58 0.27
59 0.27
60 0.23
61 0.21
62 0.21
63 0.21
64 0.18
65 0.19
66 0.18
67 0.17
68 0.14
69 0.14
70 0.16
71 0.17
72 0.19
73 0.21
74 0.2
75 0.19
76 0.2
77 0.21
78 0.19
79 0.19
80 0.18
81 0.18
82 0.2
83 0.26
84 0.34
85 0.4
86 0.47
87 0.54
88 0.62
89 0.7
90 0.8
91 0.85
92 0.85