Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y1S3K6

Protein Details
Accession A0A1Y1S3K6   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-44SSTSKESDSEDKKKKKKKKKLSGFGRKKKSEEBasic
49-74DDSEDKKDKKDKKDKKGEKGEKGEKGBasic
NLS Segment(s)
PositionSequence
24-42KKKKKKKKKLSGFGRKKKS
54-106KKDKKDKKDKKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEK
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008160  Collagen  
Pfam View protein in Pfam  
PF01391  Collagen  
Amino Acid Sequences MMKSNRSYGWFGSSTSKESDSEDKKKKKKKKKLSGFGRKKKSEEDESTDDSEDKKDKKDKKDKKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEKGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.3
4 0.25
5 0.28
6 0.35
7 0.36
8 0.44
9 0.51
10 0.58
11 0.66
12 0.76
13 0.83
14 0.85
15 0.88
16 0.89
17 0.91
18 0.92
19 0.93
20 0.95
21 0.95
22 0.95
23 0.94
24 0.93
25 0.86
26 0.77
27 0.72
28 0.67
29 0.64
30 0.57
31 0.54
32 0.49
33 0.48
34 0.47
35 0.41
36 0.35
37 0.27
38 0.24
39 0.21
40 0.17
41 0.18
42 0.25
43 0.31
44 0.42
45 0.52
46 0.61
47 0.68
48 0.78
49 0.82
50 0.85
51 0.89
52 0.88
53 0.86
54 0.86
55 0.83
56 0.78
57 0.75
58 0.7
59 0.61
60 0.58
61 0.54
62 0.47
63 0.45
64 0.44
65 0.4
66 0.41
67 0.44
68 0.4
69 0.41
70 0.44
71 0.4
72 0.41
73 0.44
74 0.4
75 0.41
76 0.44
77 0.4
78 0.41
79 0.44
80 0.4
81 0.41
82 0.44
83 0.4
84 0.41
85 0.44
86 0.4