Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8SVW9

Protein Details
Accession A0A1V8SVW9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MEAPRRNLNRQRQRSRKTWVIVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR021986  Spherulin4  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12138  Spherulin4  
Amino Acid Sequences MEAPRRNLNRQRQRSRKTWVIVAAVLLVVILAVVIPVAVVISRRHHSTGLPSEILLPLYIYPLAGAWEPLYNALNATTDLTYIVVINPESGPGNATTPNSDFLPAIQRLNSYPNAKTVGYVRTGYGNRSIDDVLQDVETYSGWATSATGIQMHGIFFDEAPYAYSAEILEYMTRCNKAVASASGIGGNKTIIHNPGVIPDSQLMQDSTDITVVFEQSWGNYSAQEPALKALSGDRSRYSYMMHSVPSSTNLGNLVDDMSLHSSHLFVTNSDSDYYASFGSNWRSFTELVPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.84
4 0.78
5 0.74
6 0.68
7 0.61
8 0.54
9 0.46
10 0.38
11 0.28
12 0.23
13 0.15
14 0.09
15 0.05
16 0.04
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.04
27 0.07
28 0.12
29 0.15
30 0.18
31 0.21
32 0.22
33 0.23
34 0.3
35 0.36
36 0.37
37 0.35
38 0.32
39 0.31
40 0.31
41 0.3
42 0.21
43 0.14
44 0.08
45 0.09
46 0.09
47 0.07
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.06
54 0.07
55 0.08
56 0.09
57 0.1
58 0.08
59 0.09
60 0.09
61 0.08
62 0.08
63 0.1
64 0.08
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.09
81 0.1
82 0.11
83 0.12
84 0.12
85 0.14
86 0.14
87 0.14
88 0.12
89 0.11
90 0.17
91 0.16
92 0.16
93 0.15
94 0.15
95 0.15
96 0.19
97 0.23
98 0.2
99 0.19
100 0.21
101 0.24
102 0.23
103 0.22
104 0.21
105 0.19
106 0.19
107 0.19
108 0.16
109 0.19
110 0.2
111 0.2
112 0.23
113 0.22
114 0.2
115 0.21
116 0.21
117 0.15
118 0.16
119 0.15
120 0.09
121 0.08
122 0.08
123 0.06
124 0.06
125 0.05
126 0.05
127 0.04
128 0.04
129 0.03
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.06
145 0.06
146 0.05
147 0.06
148 0.07
149 0.06
150 0.06
151 0.06
152 0.05
153 0.05
154 0.06
155 0.05
156 0.05
157 0.05
158 0.07
159 0.09
160 0.1
161 0.1
162 0.1
163 0.1
164 0.11
165 0.13
166 0.13
167 0.14
168 0.14
169 0.14
170 0.16
171 0.16
172 0.15
173 0.13
174 0.12
175 0.09
176 0.09
177 0.11
178 0.09
179 0.1
180 0.11
181 0.11
182 0.14
183 0.14
184 0.13
185 0.13
186 0.12
187 0.12
188 0.12
189 0.12
190 0.1
191 0.09
192 0.1
193 0.09
194 0.09
195 0.09
196 0.08
197 0.08
198 0.08
199 0.08
200 0.07
201 0.07
202 0.07
203 0.06
204 0.08
205 0.1
206 0.1
207 0.1
208 0.11
209 0.13
210 0.15
211 0.16
212 0.14
213 0.14
214 0.15
215 0.14
216 0.14
217 0.14
218 0.2
219 0.22
220 0.24
221 0.24
222 0.27
223 0.29
224 0.29
225 0.28
226 0.23
227 0.25
228 0.25
229 0.24
230 0.22
231 0.22
232 0.23
233 0.23
234 0.23
235 0.18
236 0.17
237 0.17
238 0.17
239 0.15
240 0.14
241 0.12
242 0.09
243 0.09
244 0.09
245 0.11
246 0.1
247 0.1
248 0.1
249 0.09
250 0.1
251 0.14
252 0.13
253 0.11
254 0.17
255 0.19
256 0.21
257 0.22
258 0.22
259 0.18
260 0.18
261 0.2
262 0.15
263 0.13
264 0.11
265 0.15
266 0.22
267 0.24
268 0.25
269 0.25
270 0.27
271 0.27