Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8SUD7

Protein Details
Accession A0A1V8SUD7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
16-38ILRAVPKKKTSHMKKRHRFMAGKBasic
NLS Segment(s)
PositionSequence
20-35VPKKKTSHMKKRHRFM
Subcellular Location(s) mito 16.5, cyto_mito 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MSPVASPRFGNYDRGILRAVPKKKTSHMKKRHRFMAGKGLKDVTALNKCSACGKLKRAHVLCPYCVQSIRQWFGNGFKTEAEVKAQKDAQWDEMNERLQKAGRKPLLKEDVEDLART
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.28
4 0.34
5 0.38
6 0.41
7 0.4
8 0.44
9 0.46
10 0.53
11 0.63
12 0.66
13 0.68
14 0.73
15 0.78
16 0.83
17 0.88
18 0.88
19 0.86
20 0.78
21 0.72
22 0.72
23 0.67
24 0.59
25 0.52
26 0.44
27 0.35
28 0.32
29 0.28
30 0.23
31 0.22
32 0.21
33 0.21
34 0.2
35 0.21
36 0.22
37 0.23
38 0.22
39 0.21
40 0.25
41 0.3
42 0.33
43 0.41
44 0.4
45 0.43
46 0.46
47 0.44
48 0.4
49 0.37
50 0.36
51 0.29
52 0.28
53 0.24
54 0.21
55 0.26
56 0.26
57 0.25
58 0.23
59 0.23
60 0.26
61 0.31
62 0.28
63 0.22
64 0.2
65 0.21
66 0.21
67 0.21
68 0.22
69 0.19
70 0.19
71 0.23
72 0.25
73 0.24
74 0.28
75 0.29
76 0.29
77 0.3
78 0.3
79 0.28
80 0.32
81 0.35
82 0.31
83 0.3
84 0.27
85 0.27
86 0.32
87 0.34
88 0.39
89 0.43
90 0.46
91 0.49
92 0.57
93 0.62
94 0.57
95 0.54
96 0.48
97 0.48