Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8T1A3

Protein Details
Accession A0A1V8T1A3   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
101-120ANPKAVKKVKKATPPKKVYTHydrophilic
NLS Segment(s)
PositionSequence
45-71KPGRPKKAVGEPSRVIKRAVKRVAKKP
92-142PKTKAKAKAANPKAVKKVKKATPPKKVYTEAQLAAKKERAARAKAAKDVKS
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MLGRQVTFLLRGPQLPLRLATSSKQCLSARSLHTTPAALGVVASKPGRPKKAVGEPSRVIKRAVKRVAKKPASDPDDAASQQVAAKQAGTTPKTKAKAKAANPKAVKKVKKATPPKKVYTEAQLAAKKERAARAKAAKDVKSLKAAALSPPKIVPSNAYLQFIQAHKGDLQSLVNAEKEKLPEGSKLNIKGTLTEHSKNLSAAWKEQSPADIEHFNHLAHTTTETHQAAYKSWVQSHTPDEIKLANSARRSLRRRESSSSSGSEPAKNRRTRWPAILDEREPKAAVQPYIQFSIARNASGDFKHLPLIERSKLIGEEWKALEKYETLHSADRERYIDEYSSVHGHAPLAQLEGQHPELTSAASAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.3
4 0.28
5 0.29
6 0.3
7 0.31
8 0.34
9 0.37
10 0.37
11 0.42
12 0.39
13 0.4
14 0.43
15 0.46
16 0.43
17 0.45
18 0.44
19 0.4
20 0.41
21 0.38
22 0.33
23 0.28
24 0.23
25 0.15
26 0.14
27 0.13
28 0.12
29 0.15
30 0.15
31 0.14
32 0.22
33 0.3
34 0.36
35 0.37
36 0.4
37 0.46
38 0.56
39 0.64
40 0.62
41 0.64
42 0.62
43 0.68
44 0.71
45 0.63
46 0.55
47 0.52
48 0.54
49 0.55
50 0.61
51 0.62
52 0.63
53 0.72
54 0.8
55 0.79
56 0.75
57 0.72
58 0.73
59 0.68
60 0.62
61 0.54
62 0.45
63 0.43
64 0.39
65 0.32
66 0.22
67 0.17
68 0.16
69 0.16
70 0.16
71 0.11
72 0.11
73 0.11
74 0.14
75 0.2
76 0.22
77 0.22
78 0.25
79 0.32
80 0.38
81 0.43
82 0.46
83 0.49
84 0.56
85 0.62
86 0.68
87 0.68
88 0.71
89 0.72
90 0.71
91 0.71
92 0.71
93 0.67
94 0.64
95 0.67
96 0.66
97 0.7
98 0.75
99 0.76
100 0.78
101 0.81
102 0.79
103 0.76
104 0.72
105 0.65
106 0.6
107 0.56
108 0.48
109 0.46
110 0.43
111 0.39
112 0.37
113 0.37
114 0.32
115 0.3
116 0.34
117 0.32
118 0.32
119 0.38
120 0.44
121 0.45
122 0.5
123 0.53
124 0.48
125 0.48
126 0.5
127 0.45
128 0.4
129 0.37
130 0.3
131 0.27
132 0.26
133 0.25
134 0.28
135 0.27
136 0.23
137 0.23
138 0.24
139 0.22
140 0.22
141 0.18
142 0.13
143 0.19
144 0.2
145 0.21
146 0.2
147 0.2
148 0.23
149 0.21
150 0.21
151 0.14
152 0.14
153 0.12
154 0.13
155 0.12
156 0.1
157 0.1
158 0.08
159 0.09
160 0.08
161 0.09
162 0.09
163 0.09
164 0.1
165 0.1
166 0.11
167 0.12
168 0.12
169 0.15
170 0.17
171 0.2
172 0.22
173 0.23
174 0.23
175 0.24
176 0.22
177 0.2
178 0.2
179 0.21
180 0.22
181 0.22
182 0.21
183 0.21
184 0.21
185 0.2
186 0.19
187 0.19
188 0.16
189 0.17
190 0.19
191 0.19
192 0.19
193 0.19
194 0.19
195 0.15
196 0.16
197 0.15
198 0.16
199 0.15
200 0.17
201 0.18
202 0.17
203 0.15
204 0.14
205 0.13
206 0.1
207 0.12
208 0.12
209 0.12
210 0.18
211 0.18
212 0.18
213 0.2
214 0.2
215 0.19
216 0.2
217 0.24
218 0.19
219 0.21
220 0.23
221 0.22
222 0.24
223 0.26
224 0.28
225 0.25
226 0.23
227 0.23
228 0.22
229 0.21
230 0.22
231 0.21
232 0.2
233 0.2
234 0.24
235 0.29
236 0.37
237 0.41
238 0.46
239 0.53
240 0.59
241 0.63
242 0.65
243 0.67
244 0.63
245 0.63
246 0.58
247 0.5
248 0.46
249 0.42
250 0.41
251 0.38
252 0.42
253 0.46
254 0.48
255 0.5
256 0.55
257 0.61
258 0.61
259 0.63
260 0.61
261 0.6
262 0.64
263 0.67
264 0.61
265 0.59
266 0.56
267 0.5
268 0.44
269 0.36
270 0.33
271 0.3
272 0.27
273 0.24
274 0.26
275 0.28
276 0.3
277 0.3
278 0.25
279 0.22
280 0.29
281 0.27
282 0.22
283 0.2
284 0.19
285 0.22
286 0.21
287 0.24
288 0.17
289 0.17
290 0.21
291 0.21
292 0.23
293 0.26
294 0.32
295 0.31
296 0.31
297 0.31
298 0.29
299 0.28
300 0.27
301 0.28
302 0.24
303 0.27
304 0.27
305 0.32
306 0.3
307 0.3
308 0.3
309 0.24
310 0.24
311 0.24
312 0.25
313 0.22
314 0.27
315 0.29
316 0.33
317 0.36
318 0.37
319 0.33
320 0.31
321 0.31
322 0.29
323 0.28
324 0.24
325 0.22
326 0.21
327 0.22
328 0.21
329 0.2
330 0.17
331 0.16
332 0.17
333 0.19
334 0.17
335 0.17
336 0.17
337 0.17
338 0.18
339 0.22
340 0.21
341 0.19
342 0.19
343 0.17
344 0.17
345 0.16