Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8T9N2

Protein Details
Accession A0A1V8T9N2    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MPAIRGSESKKKTRRYTRALDQVHAHydrophilic
64-90TNFVAHQKGKPHKRRVKQLKDEPYSQKHydrophilic
NLS Segment(s)
PositionSequence
72-79GKPHKRRV
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000690  Matrin/U1-C_Znf_C2H2  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS50171  ZF_MATRIN  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MPAIRGSESKKKTRRYTRALDQVHADLASQRHLELYHETKAPEELPALGQYYCKECAKWYESETNFVAHQKGKPHKRRVKQLKDEPYSQKEAEAAIGLRTDNGRRKMEREEMAVEDEVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.84
4 0.84
5 0.86
6 0.8
7 0.72
8 0.64
9 0.55
10 0.48
11 0.38
12 0.27
13 0.2
14 0.17
15 0.18
16 0.14
17 0.13
18 0.12
19 0.12
20 0.14
21 0.17
22 0.2
23 0.2
24 0.21
25 0.22
26 0.21
27 0.22
28 0.21
29 0.16
30 0.12
31 0.09
32 0.09
33 0.1
34 0.1
35 0.09
36 0.1
37 0.1
38 0.12
39 0.14
40 0.13
41 0.13
42 0.12
43 0.17
44 0.19
45 0.21
46 0.21
47 0.27
48 0.27
49 0.31
50 0.3
51 0.26
52 0.24
53 0.23
54 0.22
55 0.15
56 0.17
57 0.21
58 0.3
59 0.39
60 0.48
61 0.59
62 0.66
63 0.73
64 0.82
65 0.85
66 0.87
67 0.87
68 0.88
69 0.88
70 0.83
71 0.82
72 0.78
73 0.73
74 0.67
75 0.56
76 0.47
77 0.36
78 0.32
79 0.25
80 0.19
81 0.15
82 0.1
83 0.11
84 0.1
85 0.1
86 0.12
87 0.17
88 0.23
89 0.3
90 0.35
91 0.37
92 0.41
93 0.48
94 0.54
95 0.53
96 0.5
97 0.47
98 0.44
99 0.45