Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TJV9

Protein Details
Accession A0A1V8TJV9   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
237-262VRAEHEEQDRRRRRERARAEVRVFNPBasic
NLS Segment(s)
PositionSequence
247-252RRRRER
Subcellular Location(s) cyto_nucl 12.5, nucl 11, cyto 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019258  Mediator_Med4  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF10018  Med4  
Amino Acid Sequences MNAQLQSSYHTLEQALQRLTDSIATYNPNPVYADELVAANDAVDRDLELLAAHQSNYTRIQSLRAQSASLDSTLRSTITQLAQARKDILAIPPASSPGPTDQANELNVDTLLRYAALIAPTTVPPTLRKPIPSIEFPRVKLEGDGSVERVGGLSTPPPQPEGEQGDVKEAIVGIERIGELERGWLAGNGDVGFVPWVSDEAIRGGALAKLEGIGEGSGEVSGMEVDQQGDGGAEEEVRAEHEEQDRRRRRERARAEVRVFNPDDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.25
4 0.25
5 0.25
6 0.25
7 0.22
8 0.19
9 0.14
10 0.15
11 0.19
12 0.19
13 0.25
14 0.24
15 0.23
16 0.23
17 0.21
18 0.24
19 0.21
20 0.21
21 0.15
22 0.15
23 0.14
24 0.14
25 0.13
26 0.08
27 0.08
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.06
37 0.08
38 0.09
39 0.09
40 0.09
41 0.1
42 0.12
43 0.16
44 0.17
45 0.17
46 0.17
47 0.21
48 0.25
49 0.29
50 0.32
51 0.29
52 0.28
53 0.26
54 0.28
55 0.25
56 0.2
57 0.17
58 0.11
59 0.11
60 0.12
61 0.12
62 0.09
63 0.09
64 0.12
65 0.12
66 0.18
67 0.21
68 0.25
69 0.26
70 0.27
71 0.28
72 0.24
73 0.24
74 0.19
75 0.17
76 0.16
77 0.15
78 0.15
79 0.14
80 0.15
81 0.15
82 0.13
83 0.13
84 0.1
85 0.13
86 0.13
87 0.14
88 0.15
89 0.17
90 0.17
91 0.17
92 0.14
93 0.12
94 0.11
95 0.09
96 0.07
97 0.06
98 0.05
99 0.04
100 0.04
101 0.03
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.07
108 0.08
109 0.08
110 0.07
111 0.09
112 0.13
113 0.17
114 0.18
115 0.19
116 0.2
117 0.25
118 0.27
119 0.31
120 0.31
121 0.34
122 0.36
123 0.36
124 0.37
125 0.33
126 0.3
127 0.25
128 0.22
129 0.16
130 0.15
131 0.15
132 0.12
133 0.12
134 0.11
135 0.11
136 0.1
137 0.08
138 0.05
139 0.05
140 0.05
141 0.08
142 0.1
143 0.1
144 0.12
145 0.12
146 0.13
147 0.17
148 0.21
149 0.21
150 0.21
151 0.21
152 0.22
153 0.22
154 0.21
155 0.17
156 0.11
157 0.08
158 0.07
159 0.07
160 0.04
161 0.05
162 0.05
163 0.05
164 0.06
165 0.06
166 0.05
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.07
174 0.09
175 0.07
176 0.08
177 0.07
178 0.07
179 0.07
180 0.06
181 0.05
182 0.04
183 0.05
184 0.05
185 0.06
186 0.06
187 0.07
188 0.08
189 0.07
190 0.07
191 0.08
192 0.08
193 0.08
194 0.07
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.05
201 0.04
202 0.04
203 0.05
204 0.04
205 0.04
206 0.04
207 0.03
208 0.04
209 0.03
210 0.04
211 0.04
212 0.05
213 0.05
214 0.05
215 0.05
216 0.05
217 0.05
218 0.06
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.07
225 0.09
226 0.1
227 0.14
228 0.22
229 0.3
230 0.37
231 0.48
232 0.57
233 0.62
234 0.7
235 0.75
236 0.78
237 0.81
238 0.84
239 0.84
240 0.85
241 0.88
242 0.86
243 0.85
244 0.78
245 0.76