Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8T5I8

Protein Details
Accession A0A1V8T5I8   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-108QLTPVSSKAPKRKVRTRAGGKTTRLKYHydrophilic
NLS Segment(s)
PositionSequence
89-106KAPKRKVRTRAGGKTTRL
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLQRRTSGVRKPKLPDVPGNSDFQRALVEDLEKQQENVLADAKELGTYDQAKQMLDVYRRLISGPSKFIPALNAYHPPLQMQLTPVSSKAPKRKVRTRAGGKTTRLKYLPRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.69
3 0.66
4 0.67
5 0.62
6 0.6
7 0.52
8 0.46
9 0.41
10 0.32
11 0.25
12 0.17
13 0.17
14 0.13
15 0.14
16 0.13
17 0.16
18 0.2
19 0.18
20 0.18
21 0.17
22 0.18
23 0.17
24 0.16
25 0.16
26 0.12
27 0.12
28 0.12
29 0.11
30 0.09
31 0.08
32 0.07
33 0.07
34 0.08
35 0.09
36 0.12
37 0.13
38 0.12
39 0.12
40 0.15
41 0.16
42 0.17
43 0.17
44 0.16
45 0.16
46 0.17
47 0.17
48 0.16
49 0.16
50 0.17
51 0.19
52 0.18
53 0.19
54 0.19
55 0.19
56 0.19
57 0.17
58 0.17
59 0.15
60 0.19
61 0.19
62 0.21
63 0.21
64 0.2
65 0.19
66 0.18
67 0.17
68 0.15
69 0.15
70 0.16
71 0.16
72 0.16
73 0.19
74 0.22
75 0.29
76 0.36
77 0.44
78 0.5
79 0.59
80 0.68
81 0.74
82 0.8
83 0.83
84 0.85
85 0.85
86 0.86
87 0.85
88 0.82
89 0.82
90 0.76
91 0.73
92 0.65