Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NM65

Protein Details
Accession G9NM65   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
353-378VGSNVRSRTGRKKKNRVVNLRKTKSEHydrophilic
NLS Segment(s)
PositionSequence
360-368RTGRKKKNR
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, cyto 5.5, mito 4, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027536  Mdm34  
IPR031468  SMP_LBD  
Gene Ontology GO:0032865  C:ERMES complex  
GO:0008289  F:lipid binding  
GO:0006869  P:lipid transport  
GO:0000002  P:mitochondrial genome maintenance  
PROSITE View protein in PROSITE  
PS51847  SMP  
CDD cd21673  SMP_Mdm34  
Amino Acid Sequences MAFNFNWSPLTADAEFYSRARDLLTKALNKSPKPPIIVDDILVSEFNLGTVPPDLEILEIGDLAEDRFRGIFKMCYSGDAYLTLKTRVQANPLNTYLSSKPEFTSPQPLAAASGLTIPLSITLSEIKLSAFIILVFSKQKGLTLVFRNDPLESLKVSSTFDSIQFVRDYLQRTIEQQLRNLMMDELPAIIHRLSLQLWCPDQANKGVETPKEETDEEGVNPLSSPPLDPVDANGNVLDPSAISEISLNGGGETQSLFSQKNLLRLAALTDSHRTLSLFTPGIRDVVFRAWSGCADRADPATPSISSPNRVRTNSHAGGTSTTYTFSDTASTLHGSVSSRPSFASVNASTGLGVGSNVRSRTGRKKKNRVVNLRKTKSEAVTPDSQSEAGTNTPNSVNIPLSEPIMDIPEEEELQLHDNPFTSDPFNPQTLMSDIGDNTLTLEELTSALKDLKMLADATANSRKATPEKGSPRETPGAKGQSSPDPLDQDWVMKMASEIARRVYDEKRSQQRGKWDESEEAPPPAYEASPQSPCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.2
4 0.23
5 0.18
6 0.18
7 0.18
8 0.2
9 0.2
10 0.27
11 0.35
12 0.37
13 0.41
14 0.49
15 0.55
16 0.53
17 0.59
18 0.59
19 0.57
20 0.55
21 0.53
22 0.49
23 0.49
24 0.48
25 0.41
26 0.33
27 0.28
28 0.24
29 0.22
30 0.19
31 0.11
32 0.1
33 0.09
34 0.07
35 0.06
36 0.06
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.06
53 0.07
54 0.08
55 0.08
56 0.09
57 0.12
58 0.16
59 0.16
60 0.23
61 0.22
62 0.25
63 0.27
64 0.26
65 0.25
66 0.23
67 0.23
68 0.2
69 0.22
70 0.21
71 0.2
72 0.2
73 0.25
74 0.24
75 0.3
76 0.32
77 0.34
78 0.39
79 0.39
80 0.4
81 0.34
82 0.37
83 0.32
84 0.31
85 0.29
86 0.24
87 0.23
88 0.25
89 0.28
90 0.27
91 0.35
92 0.3
93 0.31
94 0.31
95 0.3
96 0.27
97 0.23
98 0.2
99 0.11
100 0.11
101 0.08
102 0.07
103 0.07
104 0.05
105 0.06
106 0.07
107 0.06
108 0.06
109 0.07
110 0.08
111 0.09
112 0.09
113 0.08
114 0.08
115 0.08
116 0.07
117 0.06
118 0.06
119 0.07
120 0.07
121 0.09
122 0.1
123 0.1
124 0.12
125 0.12
126 0.13
127 0.13
128 0.16
129 0.21
130 0.26
131 0.3
132 0.3
133 0.32
134 0.32
135 0.3
136 0.29
137 0.25
138 0.2
139 0.16
140 0.16
141 0.14
142 0.14
143 0.15
144 0.15
145 0.14
146 0.13
147 0.13
148 0.15
149 0.14
150 0.15
151 0.14
152 0.14
153 0.14
154 0.16
155 0.2
156 0.18
157 0.22
158 0.2
159 0.22
160 0.28
161 0.32
162 0.31
163 0.28
164 0.31
165 0.29
166 0.28
167 0.27
168 0.21
169 0.15
170 0.14
171 0.12
172 0.08
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.07
180 0.07
181 0.08
182 0.1
183 0.13
184 0.13
185 0.14
186 0.15
187 0.16
188 0.17
189 0.2
190 0.19
191 0.17
192 0.2
193 0.22
194 0.21
195 0.24
196 0.26
197 0.23
198 0.24
199 0.24
200 0.21
201 0.2
202 0.21
203 0.16
204 0.15
205 0.13
206 0.1
207 0.1
208 0.09
209 0.07
210 0.06
211 0.06
212 0.06
213 0.08
214 0.08
215 0.08
216 0.1
217 0.14
218 0.14
219 0.14
220 0.12
221 0.11
222 0.1
223 0.1
224 0.09
225 0.04
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.06
233 0.06
234 0.05
235 0.04
236 0.05
237 0.04
238 0.04
239 0.04
240 0.04
241 0.05
242 0.06
243 0.06
244 0.06
245 0.13
246 0.14
247 0.19
248 0.2
249 0.19
250 0.18
251 0.18
252 0.19
253 0.14
254 0.13
255 0.09
256 0.1
257 0.1
258 0.11
259 0.11
260 0.09
261 0.1
262 0.1
263 0.12
264 0.11
265 0.11
266 0.13
267 0.13
268 0.13
269 0.12
270 0.11
271 0.09
272 0.11
273 0.11
274 0.1
275 0.1
276 0.1
277 0.11
278 0.12
279 0.13
280 0.12
281 0.11
282 0.12
283 0.12
284 0.13
285 0.13
286 0.12
287 0.11
288 0.1
289 0.1
290 0.15
291 0.15
292 0.18
293 0.2
294 0.28
295 0.32
296 0.33
297 0.34
298 0.36
299 0.43
300 0.42
301 0.4
302 0.33
303 0.28
304 0.28
305 0.28
306 0.23
307 0.14
308 0.12
309 0.11
310 0.11
311 0.11
312 0.1
313 0.09
314 0.08
315 0.09
316 0.1
317 0.1
318 0.09
319 0.09
320 0.1
321 0.09
322 0.12
323 0.17
324 0.16
325 0.15
326 0.15
327 0.17
328 0.16
329 0.16
330 0.2
331 0.15
332 0.16
333 0.16
334 0.16
335 0.14
336 0.14
337 0.13
338 0.06
339 0.06
340 0.05
341 0.06
342 0.09
343 0.09
344 0.11
345 0.13
346 0.17
347 0.28
348 0.39
349 0.47
350 0.56
351 0.67
352 0.74
353 0.83
354 0.89
355 0.89
356 0.89
357 0.9
358 0.91
359 0.85
360 0.79
361 0.73
362 0.67
363 0.58
364 0.53
365 0.45
366 0.4
367 0.41
368 0.39
369 0.36
370 0.33
371 0.3
372 0.25
373 0.22
374 0.17
375 0.12
376 0.13
377 0.11
378 0.12
379 0.13
380 0.13
381 0.14
382 0.14
383 0.14
384 0.12
385 0.15
386 0.14
387 0.15
388 0.14
389 0.13
390 0.12
391 0.12
392 0.11
393 0.08
394 0.08
395 0.09
396 0.09
397 0.09
398 0.09
399 0.08
400 0.11
401 0.12
402 0.12
403 0.11
404 0.11
405 0.13
406 0.14
407 0.15
408 0.15
409 0.15
410 0.19
411 0.22
412 0.23
413 0.22
414 0.21
415 0.22
416 0.21
417 0.23
418 0.18
419 0.17
420 0.15
421 0.16
422 0.16
423 0.13
424 0.12
425 0.09
426 0.09
427 0.06
428 0.07
429 0.06
430 0.06
431 0.07
432 0.06
433 0.07
434 0.08
435 0.08
436 0.09
437 0.09
438 0.09
439 0.11
440 0.11
441 0.1
442 0.12
443 0.13
444 0.19
445 0.25
446 0.25
447 0.24
448 0.25
449 0.28
450 0.29
451 0.34
452 0.34
453 0.37
454 0.46
455 0.53
456 0.58
457 0.58
458 0.61
459 0.63
460 0.59
461 0.53
462 0.53
463 0.52
464 0.47
465 0.46
466 0.43
467 0.42
468 0.46
469 0.44
470 0.39
471 0.37
472 0.36
473 0.38
474 0.34
475 0.29
476 0.25
477 0.23
478 0.18
479 0.14
480 0.14
481 0.16
482 0.2
483 0.21
484 0.22
485 0.25
486 0.27
487 0.29
488 0.33
489 0.33
490 0.38
491 0.44
492 0.52
493 0.59
494 0.67
495 0.72
496 0.73
497 0.78
498 0.75
499 0.75
500 0.71
501 0.65
502 0.61
503 0.58
504 0.59
505 0.51
506 0.46
507 0.39
508 0.32
509 0.29
510 0.25
511 0.21
512 0.18
513 0.2
514 0.24