FuNGI

G9NM65

Protein Details

Accession

G9NM65

Localization Confidence

Medium

Confidence Score

11.7

NoLS Segment(s)

Position	Sequence	Protein Nature
353-378	VGSNVRSRTGRKKKNRVVNLRKTKSE	Hydrophilic

NLS Segment(s)

Position	Sequence
360-368	RTGRKKKNR

Subcellular Location(s)

nucl 12.5, cyto_nucl 9.5, cyto 5.5, mito 4, golg 2

Family & Domain DBs

InterPro	View protein in InterPro IPR027536 Mdm34 IPR031468 SMP_LBD
Gene Ontology	GO:0032865 C:ERMES complex GO:0008289 F:lipid binding GO:0006869 P:lipid transport GO:0000002 P:mitochondrial genome maintenance
PROSITE	View protein in PROSITE PS51847 SMP
CDD	cd21673 SMP_Mdm34

Amino Acid Sequences

MAFNFNWSPLTADAEFYSRARDLLTKALNKSPKPPIIVDDILVSEFNLGTVPPDLEILEIGDLAEDRFRGIFKMCYSGDAYLTLKTRVQANPLNTYLSSKPEFTSPQPLAAASGLTIPLSITLSEIKLSAFIILVFSKQKGLTLVFRNDPLESLKVSSTFDSIQFVRDYLQRTIEQQLRNLMMDELPAIIHRLSLQLWCPDQANKGVETPKEETDEEGVNPLSSPPLDPVDANGNVLDPSAISEISLNGGGETQSLFSQKNLLRLAALTDSHRTLSLFTPGIRDVVFRAWSGCADRADPATPSISSPNRVRTNSHAGGTSTTYTFSDTASTLHGSVSSRPSFASVNASTGLGVGSNVRSRTGRKKKNRVVNLRKTKSEAVTPDSQSEAGTNTPNSVNIPLSEPIMDIPEEEELQLHDNPFTSDPFNPQTLMSDIGDNTLTLEELTSALKDLKMLADATANSRKATPEKGSPRETPGAKGQSSPDPLDQDWVMKMASEIARRVYDEKRSQQRGKWDESEEAPPPAYEASPQSPCH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.23
3	0.2
4	0.23
5	0.18
6	0.18
7	0.18
8	0.2
9	0.2
10	0.27
11	0.35
12	0.37
13	0.41
14	0.49
15	0.55
16	0.53
17	0.59
18	0.59
19	0.57
20	0.55
21	0.53
22	0.49
23	0.49
24	0.48
25	0.41
26	0.33
27	0.28
28	0.24
29	0.22
30	0.19
31	0.11
32	0.1
33	0.09
34	0.07
35	0.06
36	0.06
37	0.08
38	0.09
39	0.08
40	0.09
41	0.09
42	0.09
43	0.09
44	0.09
45	0.07
46	0.07
47	0.06
48	0.06
49	0.06
50	0.06
51	0.07
52	0.06
53	0.07
54	0.08
55	0.08
56	0.09
57	0.12
58	0.16
59	0.16
60	0.23
61	0.22
62	0.25
63	0.27
64	0.26
65	0.25
66	0.23
67	0.23
68	0.2
69	0.22
70	0.21
71	0.2
72	0.2
73	0.25
74	0.24
75	0.3
76	0.32
77	0.34
78	0.39
79	0.39
80	0.4
81	0.34
82	0.37
83	0.32
84	0.31
85	0.29
86	0.24
87	0.23
88	0.25
89	0.28
90	0.27
91	0.35
92	0.3
93	0.31
94	0.31
95	0.3
96	0.27
97	0.23
98	0.2
99	0.11
100	0.11
101	0.08
102	0.07
103	0.07
104	0.05
105	0.06
106	0.07
107	0.06
108	0.06
109	0.07
110	0.08
111	0.09
112	0.09
113	0.08
114	0.08
115	0.08
116	0.07
117	0.06
118	0.06
119	0.07
120	0.07
121	0.09
122	0.1
123	0.1
124	0.12
125	0.12
126	0.13
127	0.13
128	0.16
129	0.21
130	0.26
131	0.3
132	0.3
133	0.32
134	0.32
135	0.3
136	0.29
137	0.25
138	0.2
139	0.16
140	0.16
141	0.14
142	0.14
143	0.15
144	0.15
145	0.14
146	0.13
147	0.13
148	0.15
149	0.14
150	0.15
151	0.14
152	0.14
153	0.14
154	0.16
155	0.2
156	0.18
157	0.22
158	0.2
159	0.22
160	0.28
161	0.32
162	0.31
163	0.28
164	0.31
165	0.29
166	0.28
167	0.27
168	0.21
169	0.15
170	0.14
171	0.12
172	0.08
173	0.06
174	0.06
175	0.06
176	0.06
177	0.06
178	0.06
179	0.07
180	0.07
181	0.08
182	0.1
183	0.13
184	0.13
185	0.14
186	0.15
187	0.16
188	0.17
189	0.2
190	0.19
191	0.17
192	0.2
193	0.22
194	0.21
195	0.24
196	0.26
197	0.23
198	0.24
199	0.24
200	0.21
201	0.2
202	0.21
203	0.16
204	0.15
205	0.13
206	0.1
207	0.1
208	0.09
209	0.07
210	0.06
211	0.06
212	0.06
213	0.08
214	0.08
215	0.08
216	0.1
217	0.14
218	0.14
219	0.14
220	0.12
221	0.11
222	0.1
223	0.1
224	0.09
225	0.04
226	0.05
227	0.05
228	0.05
229	0.05
230	0.05
231	0.05
232	0.06
233	0.06
234	0.05
235	0.04
236	0.05
237	0.04
238	0.04
239	0.04
240	0.04
241	0.05
242	0.06
243	0.06
244	0.06
245	0.13
246	0.14
247	0.19
248	0.2
249	0.19
250	0.18
251	0.18
252	0.19
253	0.14
254	0.13
255	0.09
256	0.1
257	0.1
258	0.11
259	0.11
260	0.09
261	0.1
262	0.1
263	0.12
264	0.11
265	0.11
266	0.13
267	0.13
268	0.13
269	0.12
270	0.11
271	0.09
272	0.11
273	0.11
274	0.1
275	0.1
276	0.1
277	0.11
278	0.12
279	0.13
280	0.12
281	0.11
282	0.12
283	0.12
284	0.13
285	0.13
286	0.12
287	0.11
288	0.1
289	0.1
290	0.15
291	0.15
292	0.18
293	0.2
294	0.28
295	0.32
296	0.33
297	0.34
298	0.36
299	0.43
300	0.42
301	0.4
302	0.33
303	0.28
304	0.28
305	0.28
306	0.23
307	0.14
308	0.12
309	0.11
310	0.11
311	0.11
312	0.1
313	0.09
314	0.08
315	0.09
316	0.1
317	0.1
318	0.09
319	0.09
320	0.1
321	0.09
322	0.12
323	0.17
324	0.16
325	0.15
326	0.15
327	0.17
328	0.16
329	0.16
330	0.2
331	0.15
332	0.16
333	0.16
334	0.16
335	0.14
336	0.14
337	0.13
338	0.06
339	0.06
340	0.05
341	0.06
342	0.09
343	0.09
344	0.11
345	0.13
346	0.17
347	0.28
348	0.39
349	0.47
350	0.56
351	0.67
352	0.74
353	0.83
354	0.89
355	0.89
356	0.89
357	0.9
358	0.91
359	0.85
360	0.79
361	0.73
362	0.67
363	0.58
364	0.53
365	0.45
366	0.4
367	0.41
368	0.39
369	0.36
370	0.33
371	0.3
372	0.25
373	0.22
374	0.17
375	0.12
376	0.13
377	0.11
378	0.12
379	0.13
380	0.13
381	0.14
382	0.14
383	0.14
384	0.12
385	0.15
386	0.14
387	0.15
388	0.14
389	0.13
390	0.12
391	0.12
392	0.11
393	0.08
394	0.08
395	0.09
396	0.09
397	0.09
398	0.09
399	0.08
400	0.11
401	0.12
402	0.12
403	0.11
404	0.11
405	0.13
406	0.14
407	0.15
408	0.15
409	0.15
410	0.19
411	0.22
412	0.23
413	0.22
414	0.21
415	0.22
416	0.21
417	0.23
418	0.18
419	0.17
420	0.15
421	0.16
422	0.16
423	0.13
424	0.12
425	0.09
426	0.09
427	0.06
428	0.07
429	0.06
430	0.06
431	0.07
432	0.06
433	0.07
434	0.08
435	0.08
436	0.09
437	0.09
438	0.09
439	0.11
440	0.11
441	0.1
442	0.12
443	0.13
444	0.19
445	0.25
446	0.25
447	0.24
448	0.25
449	0.28
450	0.29
451	0.34
452	0.34
453	0.37
454	0.46
455	0.53
456	0.58
457	0.58
458	0.61
459	0.63
460	0.59
461	0.53
462	0.53
463	0.52
464	0.47
465	0.46
466	0.43
467	0.42
468	0.46
469	0.44
470	0.39
471	0.37
472	0.36
473	0.38
474	0.34
475	0.29
476	0.25
477	0.23
478	0.18
479	0.14
480	0.14
481	0.16
482	0.2
483	0.21
484	0.22
485	0.25
486	0.27
487	0.29
488	0.33
489	0.33
490	0.38
491	0.44
492	0.52
493	0.59
494	0.67
495	0.72
496	0.73
497	0.78
498	0.75
499	0.75
500	0.71
501	0.65
502	0.61
503	0.58
504	0.59
505	0.51
506	0.46
507	0.39
508	0.32
509	0.29
510	0.25
511	0.21
512	0.18
513	0.2
514	0.24

G9NM65

3D AlphaFold-predicted Structure Viewer