Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8TS74

Protein Details
Accession A0A1V8TS74   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
32-54HSDSWLTRQHRKKSRRTWVCWAFHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, extr 4, cyto 3.5, mito 3, pero 3, cyto_nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGVRDPAFWKRFSVAVHMDEEAAPTRPDLKHSDSWLTRQHRKKSRRTWVCWAFWILIPAFVAGVIIAVIWVLQSGLLQKVKIGNGNGTVAQPADPNGNTVVGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.3
3 0.29
4 0.3
5 0.27
6 0.26
7 0.23
8 0.23
9 0.18
10 0.15
11 0.12
12 0.1
13 0.14
14 0.14
15 0.17
16 0.2
17 0.24
18 0.28
19 0.31
20 0.38
21 0.35
22 0.39
23 0.45
24 0.47
25 0.5
26 0.54
27 0.61
28 0.63
29 0.7
30 0.76
31 0.78
32 0.82
33 0.83
34 0.81
35 0.82
36 0.8
37 0.73
38 0.65
39 0.56
40 0.46
41 0.36
42 0.31
43 0.21
44 0.14
45 0.11
46 0.09
47 0.07
48 0.06
49 0.05
50 0.03
51 0.03
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.04
63 0.08
64 0.1
65 0.1
66 0.11
67 0.14
68 0.16
69 0.2
70 0.2
71 0.19
72 0.2
73 0.22
74 0.22
75 0.19
76 0.18
77 0.15
78 0.14
79 0.12
80 0.11
81 0.14
82 0.13
83 0.14
84 0.15
85 0.15