Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NVQ9

Protein Details
Accession G9NVQ9    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
19-44HSKRQASKVTKPKKSKPSADKLLKKFHydrophilic
67-86GPGKKGSKKLSQKGGSKKFGBasic
NLS Segment(s)
PositionSequence
7-42KKSNKAAAPKAIHSKRQASKVTKPKKSKPSADKLLK
68-86PGKKGSKKLSQKGGSKKFG
Subcellular Location(s) nucl 18, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGSIKKSNKAAAPKAIHSKRQASKVTKPKKSKPSADKLLKKFTSGMVAKTEALLGERAGHLELIGPGKKGSKKLSQKGGSKKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.62
4 0.62
5 0.62
6 0.58
7 0.62
8 0.58
9 0.62
10 0.64
11 0.59
12 0.64
13 0.68
14 0.74
15 0.74
16 0.76
17 0.77
18 0.8
19 0.82
20 0.81
21 0.8
22 0.8
23 0.8
24 0.82
25 0.81
26 0.76
27 0.77
28 0.67
29 0.59
30 0.49
31 0.4
32 0.37
33 0.29
34 0.26
35 0.19
36 0.2
37 0.19
38 0.19
39 0.18
40 0.1
41 0.1
42 0.09
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.06
50 0.07
51 0.08
52 0.11
53 0.12
54 0.13
55 0.13
56 0.19
57 0.22
58 0.26
59 0.31
60 0.37
61 0.46
62 0.55
63 0.65
64 0.68
65 0.74
66 0.8