Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P1T3

Protein Details
Accession G9P1T3   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-44VKEGRKLACRLCQKRKKKCNRKSPCSMCIKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MGSVGPTSAPSKVVKEGRKLACRLCQKRKKKCNRKSPCSMCIKLKVVCQPSTPAPTRKRRQSTKDLFARLAWCEEQLRRTIDDRNQCDECLPSTETSTDGVAERLSEIKSASRAASATVTAKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.51
4 0.57
5 0.62
6 0.62
7 0.6
8 0.6
9 0.66
10 0.68
11 0.7
12 0.72
13 0.75
14 0.83
15 0.89
16 0.92
17 0.92
18 0.93
19 0.93
20 0.94
21 0.92
22 0.92
23 0.9
24 0.87
25 0.85
26 0.79
27 0.73
28 0.69
29 0.64
30 0.55
31 0.51
32 0.49
33 0.44
34 0.41
35 0.37
36 0.33
37 0.31
38 0.35
39 0.34
40 0.35
41 0.39
42 0.47
43 0.54
44 0.6
45 0.66
46 0.68
47 0.71
48 0.74
49 0.75
50 0.74
51 0.73
52 0.66
53 0.58
54 0.51
55 0.46
56 0.36
57 0.3
58 0.21
59 0.15
60 0.15
61 0.15
62 0.16
63 0.17
64 0.18
65 0.18
66 0.2
67 0.25
68 0.28
69 0.37
70 0.39
71 0.42
72 0.41
73 0.39
74 0.39
75 0.34
76 0.3
77 0.24
78 0.21
79 0.16
80 0.16
81 0.17
82 0.17
83 0.16
84 0.15
85 0.12
86 0.11
87 0.11
88 0.09
89 0.09
90 0.09
91 0.1
92 0.1
93 0.1
94 0.11
95 0.13
96 0.15
97 0.16
98 0.16
99 0.16
100 0.16
101 0.17
102 0.17
103 0.17