Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1V8SPY5

Protein Details
Accession A0A1V8SPY5   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
129-153MEVEMQMRVQRRKRRREIPAGDVVQHydrophilic
NLS Segment(s)
PositionSequence
140-143RKRR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MNSYEPLHSIYEEDIMDLLSSPRRTFREPVPIASILAQSPPSTPLWTSSSTPSPSSTPASSAPASPTPSRTSSATHIYAMPASETTSGDIGCVDFALNADIKTGLTEMLNHESVKNDRELRGWIQRRLMEVEMQMRVQRRKRRREIPAGDVVQGVMAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.1
6 0.12
7 0.14
8 0.15
9 0.2
10 0.24
11 0.28
12 0.32
13 0.37
14 0.43
15 0.44
16 0.46
17 0.46
18 0.43
19 0.4
20 0.37
21 0.31
22 0.2
23 0.19
24 0.16
25 0.11
26 0.11
27 0.12
28 0.12
29 0.12
30 0.12
31 0.14
32 0.17
33 0.19
34 0.2
35 0.22
36 0.26
37 0.26
38 0.27
39 0.25
40 0.24
41 0.23
42 0.25
43 0.22
44 0.19
45 0.18
46 0.21
47 0.2
48 0.19
49 0.19
50 0.18
51 0.21
52 0.19
53 0.21
54 0.2
55 0.21
56 0.23
57 0.21
58 0.21
59 0.21
60 0.25
61 0.24
62 0.21
63 0.2
64 0.18
65 0.17
66 0.15
67 0.12
68 0.07
69 0.06
70 0.06
71 0.06
72 0.07
73 0.07
74 0.06
75 0.06
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.04
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.06
91 0.05
92 0.05
93 0.06
94 0.08
95 0.12
96 0.14
97 0.13
98 0.14
99 0.16
100 0.18
101 0.19
102 0.21
103 0.2
104 0.2
105 0.21
106 0.25
107 0.27
108 0.36
109 0.41
110 0.4
111 0.43
112 0.44
113 0.46
114 0.46
115 0.42
116 0.34
117 0.31
118 0.32
119 0.28
120 0.27
121 0.27
122 0.29
123 0.36
124 0.42
125 0.49
126 0.55
127 0.64
128 0.73
129 0.81
130 0.84
131 0.88
132 0.87
133 0.85
134 0.85
135 0.76
136 0.67
137 0.57
138 0.46