Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1V8SQY3

Protein Details
Accession A0A1V8SQY3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-27AAGTNPIHNKKPKKKPAGEEDEEHydrophilic
NLS Segment(s)
PositionSequence
13-69NKKPKKKPAGEEDEEDKAFKLKQIADKKAKEELAKKAGSSKGPLNTGSQGIKKSGKK
Subcellular Location(s) nucl 13, mito 13, mito_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MPSGAAGTNPIHNKKPKKKPAGEEDEEDKAFKLKQIADKKAKEELAKKAGSSKGPLNTGSQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.69
3 0.74
4 0.78
5 0.82
6 0.85
7 0.87
8 0.86
9 0.79
10 0.72
11 0.66
12 0.6
13 0.51
14 0.42
15 0.32
16 0.23
17 0.19
18 0.16
19 0.14
20 0.13
21 0.21
22 0.29
23 0.37
24 0.44
25 0.47
26 0.48
27 0.5
28 0.5
29 0.46
30 0.44
31 0.43
32 0.41
33 0.4
34 0.37
35 0.38
36 0.39
37 0.37
38 0.35
39 0.33
40 0.31
41 0.33
42 0.34
43 0.32
44 0.31
45 0.33
46 0.33
47 0.31
48 0.28
49 0.31