Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NJC4

Protein Details
Accession G9NJC4   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
123-151LVSKPAKGVKKEPKKEPKKEPKDEYESPLBasic
NLS Segment(s)
PositionSequence
90-144VKRKPAGASGGSAKKRAKATKKEESDDDVKDPKLVSKPAKGVKKEPKKEPKKEPK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.833, cyto 9, cyto_mito 5.333
Family & Domain DBs
Amino Acid Sequences MSKQDPAEQVRFLVSCIGHTTNGRPDFTLVAEELGIVTKAAADYMSNSSSLLLSSQKRYERMLKANGVNSSKPAAAKSDAGDDKTPTTPVKRKPAGASGGSAKKRAKATKKEESDDDVKDPKLVSKPAKGVKKEPKKEPKKEPKDEYESPLSDAPDSGADSDAGTSFDST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.2
4 0.21
5 0.2
6 0.21
7 0.24
8 0.29
9 0.33
10 0.32
11 0.28
12 0.28
13 0.27
14 0.26
15 0.24
16 0.16
17 0.13
18 0.12
19 0.11
20 0.09
21 0.08
22 0.07
23 0.05
24 0.05
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.06
31 0.09
32 0.1
33 0.1
34 0.1
35 0.1
36 0.1
37 0.1
38 0.09
39 0.11
40 0.12
41 0.16
42 0.21
43 0.24
44 0.26
45 0.29
46 0.36
47 0.38
48 0.42
49 0.44
50 0.44
51 0.45
52 0.47
53 0.47
54 0.42
55 0.36
56 0.31
57 0.27
58 0.22
59 0.19
60 0.16
61 0.14
62 0.13
63 0.14
64 0.13
65 0.18
66 0.18
67 0.19
68 0.19
69 0.18
70 0.18
71 0.17
72 0.18
73 0.12
74 0.17
75 0.21
76 0.27
77 0.36
78 0.37
79 0.39
80 0.4
81 0.44
82 0.43
83 0.38
84 0.34
85 0.3
86 0.35
87 0.33
88 0.35
89 0.3
90 0.31
91 0.36
92 0.41
93 0.45
94 0.48
95 0.55
96 0.61
97 0.67
98 0.66
99 0.62
100 0.6
101 0.55
102 0.47
103 0.43
104 0.36
105 0.3
106 0.28
107 0.26
108 0.24
109 0.24
110 0.27
111 0.27
112 0.3
113 0.38
114 0.44
115 0.52
116 0.52
117 0.58
118 0.63
119 0.7
120 0.72
121 0.75
122 0.79
123 0.81
124 0.87
125 0.89
126 0.9
127 0.89
128 0.91
129 0.89
130 0.87
131 0.85
132 0.8
133 0.75
134 0.72
135 0.62
136 0.55
137 0.49
138 0.41
139 0.32
140 0.28
141 0.22
142 0.16
143 0.16
144 0.13
145 0.12
146 0.11
147 0.11
148 0.11
149 0.11
150 0.1