Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9PAB5

Protein Details
Accession G9PAB5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
85-104RATRRMERRMRKAERKAERNBasic
NLS Segment(s)
PositionSequence
89-100RMERRMRKAERK
Subcellular Location(s) extr 25
Family & Domain DBs
Amino Acid Sequences MALVIGLVAAAARALASDHNGSNPGYNGNNNNGYNNGYNNGYNSNGYTRGYNNGYANNNYSGNNAACHAPFAAYGTCSHMTGSDRATRRMERRMRKAERKAERNDMIMSLMSSGSRSRAAGPAPSQPVSGVSYTNHGQGPAQRGASSEAQSVAGSYRDRMPSGAPEGYRWRDEQSRDRSRDLGSSSAMDGLPSYEQAIQKPRKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.08
4 0.11
5 0.12
6 0.13
7 0.15
8 0.16
9 0.17
10 0.17
11 0.17
12 0.17
13 0.2
14 0.22
15 0.26
16 0.33
17 0.31
18 0.32
19 0.3
20 0.31
21 0.29
22 0.27
23 0.23
24 0.19
25 0.18
26 0.18
27 0.19
28 0.17
29 0.16
30 0.16
31 0.17
32 0.17
33 0.17
34 0.17
35 0.16
36 0.2
37 0.22
38 0.24
39 0.23
40 0.27
41 0.29
42 0.29
43 0.31
44 0.28
45 0.27
46 0.24
47 0.23
48 0.2
49 0.18
50 0.16
51 0.14
52 0.13
53 0.12
54 0.12
55 0.11
56 0.09
57 0.08
58 0.09
59 0.09
60 0.08
61 0.09
62 0.12
63 0.13
64 0.13
65 0.13
66 0.12
67 0.13
68 0.14
69 0.16
70 0.19
71 0.2
72 0.22
73 0.26
74 0.29
75 0.31
76 0.39
77 0.45
78 0.48
79 0.56
80 0.64
81 0.7
82 0.74
83 0.8
84 0.8
85 0.8
86 0.79
87 0.74
88 0.72
89 0.64
90 0.56
91 0.48
92 0.39
93 0.3
94 0.22
95 0.17
96 0.1
97 0.08
98 0.06
99 0.06
100 0.05
101 0.06
102 0.07
103 0.07
104 0.08
105 0.1
106 0.11
107 0.14
108 0.15
109 0.2
110 0.22
111 0.22
112 0.21
113 0.19
114 0.2
115 0.18
116 0.17
117 0.13
118 0.1
119 0.13
120 0.13
121 0.16
122 0.14
123 0.13
124 0.13
125 0.16
126 0.21
127 0.21
128 0.21
129 0.18
130 0.19
131 0.23
132 0.25
133 0.23
134 0.18
135 0.16
136 0.16
137 0.15
138 0.15
139 0.12
140 0.11
141 0.11
142 0.11
143 0.16
144 0.17
145 0.18
146 0.18
147 0.19
148 0.21
149 0.25
150 0.28
151 0.23
152 0.25
153 0.32
154 0.35
155 0.35
156 0.33
157 0.32
158 0.35
159 0.41
160 0.46
161 0.5
162 0.57
163 0.59
164 0.61
165 0.58
166 0.54
167 0.54
168 0.47
169 0.4
170 0.31
171 0.28
172 0.26
173 0.25
174 0.23
175 0.18
176 0.14
177 0.13
178 0.12
179 0.11
180 0.12
181 0.14
182 0.15
183 0.2
184 0.3